(data stored in ACNUC6288 zone)

EMBL: CR382138.PE252

CR382138.PE252       Location/Qualifiers
FT   CDS_pept        521698..523464
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F05830g"
FT                   /old_locus_tag="DEHA0F06336g"
FT                   /old_locus_tag="DEHA-IPF8611"
FT                   /old_locus_tag="DEHA-CDS1702.1"
FT                   /product="DEHA2F05830p"
FT                   /note="similar to uniprot|P32461 Saccharomyces cerevisiae
FT                   YKL191W DPH2 Protein required along with Dph1p Kti11p Jjj3p
FT                   and Dph5p for synthesis of diphthamide which is a modified
FT                   histidine residue of translation elongation factor 2 (Eft1p
FT                   or Eft2p)"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F05830g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88940"
FT                   /db_xref="GOA:Q6BMF6"
FT                   /db_xref="InterPro:IPR010014"
FT                   /db_xref="InterPro:IPR016435"
FT                   /db_xref="InterPro:IPR042263"
FT                   /db_xref="InterPro:IPR042264"
FT                   /db_xref="InterPro:IPR042265"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BMF6"
FT                   /protein_id="CAG88940.2"
FT                   /translation="MTTEGLVVPALSTQQDDSTFEFDKVCSKTVVRSHLGLPNDATDDQ
FT                   VIKRIREYYNISEICNFLKQKVEGHELDMIPKYKHVTLQFPDSLICDSASIVHELQREL
FT                   GLMPRTEDSSEVKCSADSCCKTGKVESPLSQKLWILADTSYSSCCIDEVAAGHVNSDLV
FT                   IHFGDACLNVVESLPAAYVFGKPSLKLDSVITQFKEIYANRDSKILIMADAPHTQSLNQ
FT                   LYNILKPEYPNLAYADLYLNPSSNASIIGYDPCPSQSSILNVLNRTIIGLDNGDIDTDI
FT                   DTILLEHDLFHIEVPAVPRLLQLTTRFQSVTTFEPKSGLASQGPYPKLMRRYRYMHMAR
FT                   SAGTVGLLVNTLSLANTKTLINKIGQKIKEAGKKHYVFVVGKPNVAKLANFENIDIWCV
FT                   LGCDHQGIIIDENNEYYKPIVTPYELLLALNKDQNWSGKWVTDFNKVLEDMSLEDERNK
FT                   QEINDGSDNNEEDSDDEAPEFNPVTGQYVSTSKPLRKLHHLQISSQEQHPELDNEGSQD
FT                   LVKKFSSAVAIKDTVSTSAMHLQTRHWTGLGSDFQQNDSDEEANNEDGALVEDGRAGIA
FT                   RGYDYDRETKFQ"
     atgaccactg aaggactagt agttccagca ttgtctactc aacaagatga ttctacgttt        60
     gagtttgata aagtttgttc caagaccgtt gtcagaagtc atttgggcct tccgaatgat       120
     gcaaccgatg atcaagtcat aaagagaatt agagaatatt acaacattag tgaaatatgt       180
     aattttttga agcaaaaagt cgaagggcat gaacttgaca tgatccccaa atataaacat       240
     gttacgcttc agtttccaga ttctttgatt tgcgattctg cttctattgt acatgaacta       300
     caaagagaat taggacttat gcctcgcacc gaggattcta gcgaagtcaa gtgttctgct       360
     gatagttgct gtaagacggg taaagttgaa tctcctttat ctcaaaagct ttggatatta       420
     gcagatacat catattcatc atgctgtatt gatgaagtcg cagctggcca tgttaatagt       480
     gatcttgtta tacattttgg tgatgcctgt cttaatgttg tagaatcatt gccagcagca       540
     tatgtgtttg gtaagccaag cttgaaactt gatagtgtga ttactcaatt taaggaaatt       600
     tatgcaaata gagatctgaa aatattgatt atggcagatg cgccacatac acagtctttg       660
     aatcaattat acaatatttt aaaacctgag tatccaaatt tggcttacgc agacttgtac       720
     ttaaatccat cgtctaatgc aagtattatt ggctacgacc cttgcccatc tcaaagttcg       780
     attttgaatg tcttgaatag aacgattatc gggttagata atggcgatat agatactgat       840
     attgatacta ttttattaga gcatgatcta tttcatatag aggttcctgc tgttccacgt       900
     ttattgcagc tcacaactag atttcaatcg gtcactacgt ttgaaccaaa atctggattg       960
     gcatcccaag gcccataccc taaattaatg cgtcgttata gatatatgca tatggctcgt      1020
     tcagcaggta ctgttggttt attggtgaat actctatctt tggcgaatac aaaaactttg      1080
     ataaataaaa taggtcagaa aattaaagag gccgggaaaa agcattacgt atttgtggtt      1140
     ggaaagccta acgtagcgaa gttggctaac tttgaaaata ttgacatatg gtgtgtttta      1200
     ggttgcgacc accaagggat tattatagat gagaataatg aatattacaa gcccattgtt      1260
     actccttatg aattattgtt ggcattaaat aaagatcaga attggagtgg aaaatgggtt      1320
     actgatttca ataaggtact agaagatatg agtttagaag acgagagaaa caagcaagag      1380
     attaatgatg gaagtgataa taatgaagaa gattctgatg atgaagctcc agaatttaac      1440
     cctgttactg gccagtatgt tagtacgtct aaaccattaa gaaaattaca ccatttacaa      1500
     atctcttctc aggaacaaca ccctgaatta gataatgagg gatctcaaga tttagtgaag      1560
     aagttttcta gtgctgttgc aattaaggat accgtatcta catctgctat gcatttacaa      1620
     acgaggcact ggaccggttt aggaagtgat tttcagcaaa atgatagtga cgaggaagca      1680
     aataacgaag atggtgccct tgttgaagac ggtagagcag gaatcgcaag aggttacgat      1740
     tatgatagag aaacaaaatt tcaatga                                          1767
//

If you have problems or comments...

PBIL Back to PBIL home page