(data stored in ACNUC6288 zone)

EMBL: CR382138.PE254

CR382138.PE254       Location/Qualifiers
FT   CDS_pept        complement(join(524789..525284,525364..525392))
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F05874g"
FT                   /product="DEHA2F05874p"
FT                   /note="weakly similar to uniprot|Q04969 Saccharomyces
FT                   cerevisiae YML055W SPC2 Subunit of signal peptidase complex
FT                   (Spc1p Spc2p Spc3p Sec11p)"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F05874g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66282"
FT                   /db_xref="GOA:B5RUA4"
FT                   /db_xref="InterPro:IPR009582"
FT                   /db_xref="UniProtKB/TrEMBL:B5RUA4"
FT                   /protein_id="CAR66282.1"
FT                   /translation="MSAIKKTNLNSIVQLRATCDDNLHASLSELGYTQSFSLIDTKLAL
FT                   GYSTVVIAGLLYVVDKKFGFEKTYNVTVLSVILYFLISGILFYLTSTKKYKNVKYIGYD
FT                   DSNKKISVATWTNKYDPIYHLKIRFNDEESLAIVTSFEFMKVFDAFGYYKQDELTRLLK
FT                   NELDKINKKSN"
     atgtcagcca tcaagaagac caatttgaac tcaattgttc aattacgtgc tacgtgtgat        60
     gataatttac atgcatcatt atcagaattg ggatatacac aatccttcag tttaatagat       120
     acgaagctag ctttaggata tctgactgtt gtgatagctg gtttattata cgtggtggat       180
     aaaaaatttg gattcgagaa aacttataat gtcacagtac tctcggtaat tctttatttt       240
     ttaatcagtg gaattttatt ctatttgaca tcgacaaaga agtataagaa cgtcaagtac       300
     attggttacg acgattccaa taaaaagata ctggttgcga catggacaaa taagtacgat       360
     ccaatatacc acttgaaaat tagatttaat gatgaagaga gtttggccat tgtcactagc       420
     tttgaattta tgaaagtttt tgatgctttc ggatattata aacaagacga attaactaga       480
     ttgcttaaga atgaattgga taaaatcaac aagaagagta attga                       525
//

If you have problems or comments...

PBIL Back to PBIL home page