(data stored in ACNUC6288 zone)

EMBL: CR382138.PE256

CR382138.PE256       Location/Qualifiers
FT   CDS_pept        527847..530363
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F05918g"
FT                   /old_locus_tag="DEHA0F06446g"
FT                   /old_locus_tag="DEHA-IPF8605"
FT                   /old_locus_tag="DEHA-CDS0734.1"
FT                   /product="DEHA2F05918p"
FT                   /note="similar to uniprot|Q08919 Saccharomyces cerevisiae
FT                   YPL176C Hypothetical ORF AND uniprot|Q08693 Saccharomyces
FT                   cerevisiae YOR256c Protein required for cell viability"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F05918g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88945"
FT                   /db_xref="GOA:Q6BMF3"
FT                   /db_xref="InterPro:IPR007365"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="InterPro:IPR036757"
FT                   /db_xref="InterPro:IPR039373"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMF3"
FT                   /protein_id="CAG88945.2"
FT                   /translation="MSENHQSYERVSSNETDIPRQPPNYDDLESNLVDRTDNGIEQFEI
FT                   EDEDFEQPRENDGFMVRASFMTKKFASNFSARVMHPVSKMIDPIYEGYSHFNLLYEKSI
FT                   LKLGNPLVVKRLLYVFFIMIVIFLITKYNISDGVNGVSGGAFSSGKFYDIDMLANSARD
FT                   YIDAKVMKENLEYLSSMPHIAGSKGDLTLSKYVQSYMKENGIKMVDFEELQSFTNYPAF
FT                   DKKKTYVKLADDSYEATLYEQDKKDMEYLSYNPNSLNTNDEYESFYIYGNFGTQEDLKN
FT                   LRDHNVNLQDSILLIKYGGSIPDANKIQIAQQQGVKAVIFISSKFDIGTGDNKVTHDDV
FT                   IQKENVGVSRFSPGDVLTPGWSSEDGYVTRLPWFKSQTTPKIPTIPISWKDASHFISQL
FT                   GENGVKFDDGLYSGSKSSEAKHKIKLRITHDQRQTNQIWNIIGSIPGREQVEKGIIIGA
FT                   SRDSTCFGTMSTNTGTVILLELIKIFSALQRQYNWSPARSIYFASFDASEYNLAGSTEW
FT                   IESRKETLKKEGYAYIDLSDAVAGDDLSIKSHPFLHSVIKDALKKVKSDKDDSKHRRDD
FT                   NRISLYDLYTQQNKGSDDISNNLIDQKNYIPIINLANIPSLEIKFTGLNYPENSCYDNF
FT                   DNFEKSGVDSSMSKHKQLVELLSKIALTLAEVPIIPYNFANMASKLVSYSDDLENYANA
FT                   KINQYEKQVVPIMHFTTLRNSIDRLKTSGVRFEEWCKAWKQFVKESSDIEPSLLAMNRW
FT                   KWNDNMIELNEKFIVKYVKPPRPGYVNVLFGVPFSAPDNGNEDYEWNTFPSVRDYLEVN
FT                   DFGRAQHEIDQLANLIDSAAQQFLLL"
     atgagtgaga accaccagct gtatgagagg gtaagttcaa atgaaacaga tatacctaga        60
     cagccgccta attatgatga tttggagtct aatctagtag atagaaccga taacggaata       120
     gagcagtttg agatagaaga tgaagatttc gaacaaccaa gagaaaatga tgggttcatg       180
     gtacgggcat catttatgac gaagaaattt gcaagtaatt ttagcgctag ggtaatgcat       240
     ccggtaagca aaatgattga tcctatatac gaaggctaca gtcattttaa tctcttgtac       300
     gagaaatcca ttttaaagtt gggaaaccca ctagtggtaa agcgtttgtt atatgttttt       360
     ttcataatga tcgtcatttt tttaataaca aaatataaca ttagtgatgg tgtaaatggt       420
     gtgagtggag gagcattttc ttcgggtaaa ttttatgaca tagacatgtt ggcaaattca       480
     gcccgtgatt atattgacgc taaagtcatg aaagagaact tggaatattt gtcttcgatg       540
     ccacatatag ccggttccaa gggagatttg acattaagta aatatgtgca aagctatatg       600
     aaggagaatg ggataaagat ggttgacttc gaagaattgc aaagtttcac aaactatcca       660
     gcttttgata agaaaaaaac ctacgttaag ttagcggatg attcttatga agcaacgtta       720
     tacgagcaag ataagaaaga tatggaatat ttgtcgtata accctaactc attaaatact       780
     aatgatgagt atgaaagttt ttacatatat ggtaacttcg gcactcaaga ggaccttaaa       840
     aatttaagag atcataatgt aaatttgcaa gattcaatac ttttaatcaa gtacggcggt       900
     tcaattccgg atgcaaataa aatccagatt gcacaacaac aaggtgtgaa agctgttatt       960
     ttcattagtt caaagttcga tataggaaca ggtgataata aagtaacgca tgatgatgtg      1020
     attcagaagg aaaatgttgg tgttagtaga tttagtccag gggacgtctt aacacctggc      1080
     tggtcttctg aggacggcta tgtaactaga ttaccatggt tcaagtcaca gactactcct      1140
     aaaatcccta caatcccgat ctcttggaag gatgcttcgc attttatttc acagttgggt      1200
     gaaaatggtg taaaatttga tgatggctta tattcgggct cgaagtcctc tgaagccaaa      1260
     cataagatta aattacggat tacgcatgat caaagacaaa caaatcaaat ctggaatatt      1320
     attggatcaa tcccggggag ggaacaagta gaaaaaggta ttattattgg agctagtaga      1380
     gattcaacat gttttggtac gatgtctaca aatacaggta ccgtgatttt acttgaattg      1440
     attaaaattt tcagtgcatt gcaaagacaa tataactggt ctcctgcgag gtcaatatat      1500
     tttgcatctt ttgatgcttc cgaatacaat ttggctggat cgactgaatg gatcgagagt      1560
     agaaaggaaa cattgaaaaa ggaaggatat gcttatattg atttaagtga tgcggtagct      1620
     ggtgatgatt tactgattaa gtcacatccg ttcttacata gcgttataaa agatgctttg      1680
     aagaaggtga agagtgacaa ggatgactcc aagcataggc gtgatgacaa tagaatcagt      1740
     ctttatgatc tttatactca gcagaacaaa ggcagtgatg atatttctaa caatttaatt      1800
     gaccaaaaaa attacattcc aatcattaat ttggcgaata ttccatcatt agaaattaag      1860
     ttcactggtt taaattatcc tgaaaactct tgttatgaca attttgataa ttttgaaaaa      1920
     tctggtgttg attcttcgat gagcaagcac aagcaactag ttgaattatt atccaagatt      1980
     gcattaactt tagcagaagt acctattatt ccatataatt ttgctaacat ggcaagtaag      2040
     ttggtcagtt attccgacga tttggagaat tatgctaatg ctaagataaa tcaatatgaa      2100
     aagcaggtcg taccaattat gcattttaca actttacgta attcaataga tagattaaag      2160
     acatccggtg ttaggtttga agaatggtgc aaagcatgga agcaatttgt caaggaatca      2220
     tcggacattg agccttcctt attggcaatg aatagatgga agtggaatga taatatgata      2280
     gaactaaatg agaaatttat tgtcaaatat gtaaagccac cccgcccagg gtacgttaat      2340
     gtattatttg gagtaccatt cctggctcct gataatggca atgaggatta tgagtggaat      2400
     acattcccta gtgttaggga ttaccttgaa gtaaatgatt ttggtagagc acagcatgag      2460
     attgatcagt tggcaaattt aattgattct gcagcacaac aatttttatt attgtga         2517
//

If you have problems or comments...

PBIL Back to PBIL home page