(data stored in ACNUC6288 zone)

EMBL: CR382138.PE261

CR382138.PE261       Location/Qualifiers
FT   CDS_pept        537804..539672
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F06050g"
FT                   /old_locus_tag="DEHA0F06600g"
FT                   /old_locus_tag="DEHA-IPF8599"
FT                   /old_locus_tag="DEHA-CDS1375.1"
FT                   /product="DEHA2F06050p"
FT                   /note="similar to uniprot|Q2VQX1 Saccharomyces cerevisiae
FT                   YLR443W ECM7 Non-essential protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F06050g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88950"
FT                   /db_xref="GOA:Q6BME8"
FT                   /db_xref="InterPro:IPR009571"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BME8"
FT                   /protein_id="CAG88950.2"
FT                   /translation="MMFNNIGYHFLLPFRNLTAQARFLQIIRLFTCIAALTFIIATLIG
FT                   SLANRNIYIARINCARLDVARGLYNSLRSSVSLSSSILGDSEDNVLPVDSSLTNSEIAV
FT                   LTSYAENQVADAPQYIVTSLWSWCYGNYNITQHMDRHGVVHISKHNDVLTCSKSTKRYI
FT                   FDYKDELELIGLQSILAYAYQSSDLNDKKYEETIAKRNNKYKLVPSGLIFGASSQLVIL
FT                   IFGYILYSNRGPEQSLNKIPVFVMNIIALISVASFLSLAVSSSLVTNLLIEIRGEIKSN
FT                   LGDYGIALHFGDIWFSLLWLSFTFSLLSSVSWTFPLWCANPRDFDEEEDFDDFPYGSDN
FT                   ITDNEEAGMSDLSGLRRNPSVSDKYNRFNKTSANISSGVQYKASADFGAKNDNDVEERD
FT                   FSDDEDHEYETDYVYNDTSNRKYDAYGARNEDELRKLGETLSRKMSVRRLNRNLSKKSR
FT                   KSYLRDANYPIFEDESSNLLYHDVNISNSQYPMTDSMAHHYREETFDGYVNSHKPTTSA
FT                   STMSLGTSKILTSHINKVREEGNNTPTRNASDKSVDRRKNNKEQDTNFRSNSLQERHFQ
FT                   HNTRNNPFLQSDTLESLENKRNSTGDSFLNFDEMEILDNNNYINRL"
     atgatgttta ataatatagg gtatcatttt ttactaccct ttagaaatct cacagctcaa        60
     gcaagatttc tacaaataat aaggcttttc acatgtattg ccgcattaac atttatcatc       120
     gcaacattaa taggctccct tgctaatagg aatatatata ttgcaagaat taattgtgcc       180
     cgtttagatg ttgctcgtgg tttatataat agtttgagga gctccgtgtc tttatcctca       240
     agtattcttg gcgattcaga ggataatgtg ctacctgttg attcatcgtt aactaattcc       300
     gaaatagcag tgctaacctc atatgctgaa aatcaagttg ctgatgctcc ccaatacatt       360
     gttacctcct tatggagctg gtgctatggt aattataaca tcacacaaca catggacaga       420
     catggtgttg ttcatatatc caagcataac gatgtcctta cttgctcaaa atcgacgaag       480
     aggtatattt ttgattacaa ggatgaatta gaattgatag gtttacagag cattttagca       540
     tacgcatacc agtcttcgga tttgaatgat aaaaaatacg aagagacaat agccaaaaga       600
     aataataaat acaaattagt tccatccggc ttgatatttg gagctagttc ccagctagtt       660
     atattaatat tcggctatat tttatacagt aataggggcc cggagcaaag cctcaataaa       720
     attcctgttt ttgtgatgaa tattatagct ttaatatctg ttgcatcatt tctaagttta       780
     gctgtatcca gtagtcttgt gactaattta ttgatcgaaa ttagaggtga aattaaatct       840
     aatttggggg attatggaat tgcgttacat tttggcgata tttggttcct gttattgtgg       900
     ttgtctttta cattttcatt actttcaagt gtttcttgga ctttccctct atggtgtgcc       960
     aatccacggg attttgatga agaggaagat tttgatgatt tcccttatgg atctgataat      1020
     ataactgaca acgaggaagc gggaatgtct gacttgagcg gccttagacg taatccaagt      1080
     gtttcagata aatataatag attcaacaag acaagcgcga atatatctag tggtgttcag      1140
     tacaaagcat ctgcggattt tggtgccaaa aatgataatg atgttgaaga aagagacttt      1200
     tctgatgatg aggaccatga atacgaaact gattatgtct ataatgatac gagtaataga      1260
     aaatacgatg catatggtgc tagaaacgaa gacgagttac gaaagcttgg agaaacattg      1320
     tcaagaaaaa tgtccgttcg ccgtctaaac agaaatcttt ctaagaaaag ccgtaagtca      1380
     tacctccgtg atgcaaatta cccaatattt gaagatgaat caagtaactt attatatcac      1440
     gacgtcaata tcagtaactc acagtatcca atgaccgatt cgatggctca ccattataga      1500
     gaagagacct ttgatggcta cgtaaatagt cacaagccaa ctacaagtgc cagcactatg      1560
     tctcttggaa cgtcgaaaat cctaactagt catattaata aagttagaga agagggtaat      1620
     aatacgccta ctcgtaatgc atcagataag tctgttgata gaagaaagaa taataaagaa      1680
     caagatacaa attttaggtc taattcacta caagagagac atttccagca taatactagg      1740
     aacaatccat ttttacagag tgatacactt gaatcattag agaacaaaag aaactctaca      1800
     ggtgattcat ttttgaattt tgacgaaatg gaaatcctag acaacaacaa ttatataaat      1860
     agactttaa                                                              1869
//

If you have problems or comments...

PBIL Back to PBIL home page