(data stored in ACNUC6288 zone)

EMBL: CR382138.PE263

CR382138.PE263       Location/Qualifiers
FT   CDS_pept        complement(541486..542808)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F06094g"
FT                   /old_locus_tag="DEHA0F06644g"
FT                   /old_locus_tag="DEHA-IPF8597"
FT                   /old_locus_tag="DEHA-CDS2824.1"
FT                   /product="DEHA2F06094p"
FT                   /note="highly similar to uniprot|P06106 Saccharomyces
FT                   cerevisiae YLR303W MET17 O-acetyl homoserine-O-acetyl
FT                   serine sulfhydrylase required for sulfur amino acid
FT                   synthesis"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F06094g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88952"
FT                   /db_xref="GOA:Q6BME7"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006235"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BME7"
FT                   /protein_id="CAG88952.1"
FT                   /translation="MPSHFDTLQLHAGQPVEKPHKPRAPPIYATTSYVFDDSKHGAQLF
FT                   GLETPGYIYSRIMNPTNDVFEQRMAALEHGIGAVATSSGQSAQFLAIAGLAHVGDNFIS
FT                   TSFLYGGTYNQFKVAFKRLGIETKFVNGDKVEDFAKLIDDKTKAIYIETIGNPKYNVPD
FT                   FEAISKLAHDHGIPVVVDNTFGAGGYLINPIDHGADIVVHSATKWIGGHGTTIAGVIVD
FT                   SGNFPWEKYPERFPQFSKPSEGYHGLVLNDALGKAAFIGHVRIELLRDLGPALNPFGSF
FT                   LLLQGLETLSLRVERQSYNALKLAQFLEKSPYVEWVSYLGLPSHEYHERSKKYLNNKEN
FT                   YGGVLSFGVKDLGENKEDPFQEASPRFVDNLKVASNLANVGDSKTLIIAPYYTTHQQLS
FT                   DEEKAASGVSKDLIRVSVGTEFIDDIIGDFEQAFKTVYESS"
     atgccatctc attttgatac acttcaattg cacgctggac aaccagttga gaaaccccac        60
     aaaccaagag cgcccccaat ttatgctact acatcatatg tttttgatga ttccaagcat       120
     ggagctcaat tgtttggttt agaaacccct ggttatattt actcgcgtat tatgaatcca       180
     actaacgatg tatttgaaca aagaatggct gctctagaac acggtattgg tgcagtggcc       240
     acatcgtccg gacaatctgc acaattctta gcaattgcag gtcttgctca tgtgggagat       300
     aatttcatct ctacatcttt cttatatggt ggtacttaca atcaattcaa agttgctttt       360
     aagagattag gaatcgaaac caaattcgtt aatggggata aggttgaaga cttcgctaag       420
     cttattgatg ataagactaa agcaatctac atcgaaacca ttggaaatcc aaagtacaat       480
     gttccagatt ttgaagcaat ctctaagtta gcccatgatc atggtatacc agttgttgtg       540
     gacaatacct ttggtgctgg aggttatttg attaatccaa ttgatcacgg tgctgatatt       600
     gtcgttcact cggctaccaa atggattgga ggtcacggta ctactattgc tggtgtcatc       660
     gtcgattctg gtaatttccc atgggaaaaa tacccagaaa gattcccaca attctctaaa       720
     ccatctgagg gttaccatgg tttagtctta aatgacgctt taggcaaagc tgcttttatt       780
     ggacatgtta gaattgaatt attgagagat ttgggtccag cgttgaaccc atttggttca       840
     ttcttattat tacaaggttt agaaactttg tcattacgtg ttgaaagaca atcatacaac       900
     gctttgaaat tagctcaatt tcttgaaaaa tctccttatg ttgaatgggt ctcctacctt       960
     ggtttaccat cccacgaata ccatgaaaga agtaagaaat acttaaataa caaagaaaac      1020
     tatggtggtg ttttatcatt tggtgttaag gatttgggtg aaaataagga agatccattc      1080
     caagaggcaa gtccaagatt tgttgataac ttaaaggttg cttccaactt ggctaatgtc      1140
     ggtgattcca agactttaat cattgcacca tattacacta ctcatcaaca attaagtgac      1200
     gaagaaaagg ctgcttctgg tgtctcaaag gacttgatta gagtttctgt aggtacagaa      1260
     tttattgatg atattattgg tgatttcgaa caagccttca aaacagttta tgagtcttct      1320
     taa                                                                    1323
//

If you have problems or comments...

PBIL Back to PBIL home page