(data stored in ACNUC6288 zone)

EMBL: CR382138.PE269

CR382138.PE269       Location/Qualifiers
FT   CDS_pept        join(550977..551092,551534..552929)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F06226g"
FT                   /product="DEHA2F06226p"
FT                   /note="highly similar to uniprot|P00830 Saccharomyces
FT                   cerevisiae YJR121W ATP2 subunit of mitochondrial F1F0 ATP
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F06226g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88959"
FT                   /db_xref="GOA:Q6BME0"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BME0"
FT                   /protein_id="CAG88959.1"
FT                   /translation="MVFPRLFNSASRNAFTAAKRNFVFNRGLASAAPVAGKVRAVIGAV
FT                   VDIQFDEGNLPAILNALTLKNGDQDLVLEVAQHLGENTVRAIAMDGTDGLVRGAPVNDT
FT                   GAPISVPVGRETLGRIINVIGEPIDERGPIKTKQKNPIHADPPSFVEQSTSSEVLETGI
FT                   KVVDLLAPYARGGKIGLFGGAGVGKTVFIQELINNIAKAHGGFSVFAGVGERTREGNDL
FT                   YREMQETGVINLEGDSKVSLVFGQMNEPPGARARVALTGLTIAEYFRDEEGQDVLLFVD
FT                   NIYRFTQAGSEVSALLGRIPSAVGYQPTLATDMGLLQERITTTKKGSVTSVQAVYVPAD
FT                   DLTDPAPATTFAHLDATTVLSRGISELGIYPAVDPLDSKSRLLDIAVVGKEHYDVASGV
FT                   QQTLQAYKSLQDIIAILGMDELSEQDKLTVERARKIQRFLSQPFAVAEVFTGIPGKLVR
FT                   LQETVKSFKEVLDGKHDHLPENAFYMVGGIEDATAKAEKLASESK"
     atggtttttc caagattgtt taactctgct tcacgcaatg ctttcactgc tgctaagcgt        60
     aactttgttt tcaacagagg tttagcttca gcagctccag tcgccggtaa ggttagagct       120
     gttattggtg ctgttgttga tatccaattc gacgaaggta acttaccagc tattcttaat       180
     gctttaaccc ttaagaacgg tgaccaagac ttagtcttag aagtcgccca acatttaggt       240
     gaaaacaccg tcagagctat tgctatggat ggtaccgatg gtttagttag aggtgctcca       300
     gttaacgata ccggtgctcc aatttctgtt cctgttggtc gtgaaacctt aggtcgtatt       360
     atcaacgtta ttggtgaacc aattgacgaa agaggcccaa tcaagaccaa acaaaagaac       420
     ccaattcacg ctgatccacc ttcgttcgtc gaacaatcca cttcttccga agttttagaa       480
     accggtatta aggttgtcga tttattagcc ccatacgcca gaggtggtaa gattggttta       540
     ttcggtggtg ccggtgtcgg taaaaccgtt ttcattcaag aattgattaa caacattgct       600
     aaggcccatg gtggtttctc tgttttcgcc ggtgtcggtg aacgtaccag agaaggtaac       660
     gatttatacc gtgaaatgca agaaactggt gttattaacc ttgaaggtga ttctaaggtc       720
     tccttagttt tcggtcaaat gaacgaacca ccaggagcta gagctagagt tgctttaacc       780
     ggtttaacca ttgccgaata cttcagagat gaagaaggtc aagatgtctt gttattcgtt       840
     gataacattt acagattcac ccaagctggt tccgaagtct ctgctttgtt aggtcgtatt       900
     ccatctgctg tcggttatca accaacctta gccactgata tgggtttatt acaagaacgt       960
     attaccacca ccaagaaggg ttccgttact tctgtccaag ccgtctatgt cccagctgat      1020
     gatttaaccg atccagctcc agctaccacc ttcgcgcatt tagatgccac cactgtcttg      1080
     tctagaggta tttccgaatt aggtatttac ccagctgtcg atccattaga ttccaagtct      1140
     agattgttag atattgctgt tgtcggtaag gaacattatg acgtcgcttc cggtgtccaa      1200
     caaaccttac aagcttacaa gtctttacaa gatatcattg ctattttagg tatggatgaa      1260
     ttatctgaac aagataagtt aaccgtcgaa agagcacgta agatccaaag attcttgtct      1320
     caaccattcg ctgttgctga agttttcact ggtatcccag gtaaattagt tagattacaa      1380
     gaaaccgtca aatctttcaa ggaagtctta gatggtaagc acgatcactt accagaaaat      1440
     gctttctata tggttggtgg tattgaagat gccactgcta aagccgaaaa attagcttct      1500
     gaatctaaat aa                                                          1512
//

If you have problems or comments...

PBIL Back to PBIL home page