(data stored in ACNUC6288 zone)

EMBL: CR382138.PE271

CR382138.PE271       Location/Qualifiers
FT   CDS_pept        complement(554700..555425)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F06270g"
FT                   /old_locus_tag="DEHA0F06842g"
FT                   /old_locus_tag="DEHA-IPF8578"
FT                   /old_locus_tag="DEHA-CDS4920.1"
FT                   /product="DEHA2F06270p"
FT                   /note="similar to uniprot|Q07508 Saccharomyces cerevisiae
FT                   YDL087C LUC7 Essential protein associated with the U1 snRNP
FT                   complex"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F06270g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88961"
FT                   /db_xref="GOA:Q6BMD8"
FT                   /db_xref="InterPro:IPR004882"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMD8"
FT                   /protein_id="CAG88961.1"
FT                   /translation="MAEEQRKLVEQLMGKDALISPAVKRRDPEMTSHRVCKSFLVGVCP
FT                   HDLFIGTKQDLGKCPKLHLEKHKLEYEYRTRKKGEAFPEFEYEYYKHLQTYINEIDRNI
FT                   EIALKRLEHTPEEKEKIAKVTKELDNLDTKIGLMTQEIDCLIKENETLKCLFESVKLND
FT                   LCKERDQLAESARNIAENVGQSSQQKLQVCEECGAYLSRLDSDRRLADHLIGKIHLGYV
FT                   QMRAAYYELHNKFKRSTTY"
     atggcagaag aacaaagaaa gctcgtagag caattgatgg gtaaagatgc cttgatatcg        60
     ccagcggtaa agagaagaga tccagaaatg acaagtcata gggtgtgcaa aagtttttta       120
     gttggagttt gcccacacga tttattcatt ggaacgaagc aagacctagg aaaatgccca       180
     aaattacatc ttgagaaaca caagttagaa tatgagtaca ggactagaaa gaaaggtgag       240
     gcatttcccg aatttgaata tgaatactat aagcatctac aaacttatat aaatgaaatt       300
     gatcgaaaca tagaaatagc cttgaagcgt ttggagcata ccccagaaga aaaagagaaa       360
     atcgctaagg tgacgaagga gttagataat ttggatacaa aaataggctt aatgacacaa       420
     gaaatcgact gtttaattaa agaaaatgaa actttgaaat gtttatttga aagtgtaaaa       480
     ttgaatgact tatgcaaaga aagagaccag cttgcagaat ccgccaggaa tattgcggaa       540
     aacgttggtc agtcatctca gcaaaaatta caggtttgtg aagaatgtgg agcgtattta       600
     tcaagattag atagtgatag acggttagct gatcacttaa taggtaaaat acatttaggt       660
     tatgttcaga tgagagcagc gtattatgaa ttacataaca aattcaaaag aagtactaca       720
     tattaa                                                                  726
//

If you have problems or comments...

PBIL Back to PBIL home page