(data stored in ACNUC6288 zone)

EMBL: CR382138.PE280

CR382138.PE280       Location/Qualifiers
FT   CDS_pept        576534..577232
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F06512g"
FT                   /old_locus_tag="DEHA0F07172g"
FT                   /old_locus_tag="DEHA-IPF8555"
FT                   /old_locus_tag="DEHA-CDS5666.1"
FT                   /product="DEHA2F06512p"
FT                   /note="weakly similar to uniprot|P38242 Saccharomyces
FT                   cerevisiae YBR070C ALG14 Essential protein required for the
FT                   second step of dolichyl-linked oligosaccharide synthesis"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F06512g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88973"
FT                   /db_xref="GOA:Q6BMD0"
FT                   /db_xref="InterPro:IPR013969"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BMD0"
FT                   /protein_id="CAG88973.2"
FT                   /translation="MDFESQLCIKVVLLLLPFFIIGIRLLWVLPAVNSPAMGSEKEKGL
FT                   SQIPSELRGSNIMIFLGSGGHTGEMMRILANVDLNNFNRTWVTSSGDSTSILKCKKYED
FT                   ERLTSGQNKSDYLVLHRARTVGESIISSVFSTVRSLISTIKHLYELPQFPSILLLNGPG
FT                   TSVPLAYIIFLLKFLGLCKTRIIYIESLARVKQLSVSGLLILPITDRFIVQWKQLAVKY
FT                   KRAEYYGILI"
     atggacttcg aatcacagct atgcattaaa gtggtgttat tattgttgcc attcttcatt        60
     atcggaataa gattactttg ggttttaccg gcggtcaatt caccggccat gggatctgag       120
     aaggagaaag gattaagcca aataccttca gaattaagag ggtctaacat aatgatcttt       180
     ttaggttcag gtggacacac aggggaaatg atgcgtattt tggctaatgt tgacttgaat       240
     aattttaatc gaacatgggt tacatcatct ggtgattcga cttcaatttt aaaatgcaag       300
     aaatacgaag atgaaagact aacgagtggt caaaataaac tggactatct tgtattacat       360
     agggcgagaa ctgttggtga atctataatt ctgtcagttt ttagtacagt aaggtcactc       420
     atttctacaa ttaagcacct ctatgaatta ccacagtttc catctattct tttattgaat       480
     ggaccaggga catctgttcc actagcatac ataatatttc tattgaaatt cttgggttta       540
     tgcaagacca ggatcatcta tattgaaagt ctagcgagag ttaaacaatt gagcgtaagt       600
     ggtcttttaa tattgccaat tactgatagg tttattgttc aatggaaaca gttagccgta       660
     aaatataaaa gagccgaata ttatggtatt ttaatttaa                              699
//

If you have problems or comments...

PBIL Back to PBIL home page