(data stored in ACNUC6288 zone)

EMBL: CR382138.PE282

CR382138.PE282       Location/Qualifiers
FT   CDS_pept        complement(579948..580283)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F06556g"
FT                   /old_locus_tag="DEHA0F07216g"
FT                   /old_locus_tag="DEHA-IPF8551"
FT                   /old_locus_tag="DEHA-CDS7006.1"
FT                   /product="DEHA2F06556p"
FT                   /note="highly similar to uniprot|Q04307 Saccharomyces
FT                   cerevisiae YDR045C RPC11 RNA polymerase III subunit C11"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F06556g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88975"
FT                   /db_xref="GOA:Q6BMC8"
FT                   /db_xref="InterPro:IPR001222"
FT                   /db_xref="InterPro:IPR001529"
FT                   /db_xref="InterPro:IPR012164"
FT                   /db_xref="InterPro:IPR034014"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMC8"
FT                   /protein_id="CAG88975.2"
FT                   /translation="MLSFCPYCANMLIMAQKDDGCNRFFCSTCPYEFKIDGFQMYDRKK
FT                   LSRKEVDDVLGGEGAWDNVDQTLAQCPIDSCGGDKAYFFQLQIRSADEPMTTFYKCVKC
FT                   SHQWREN"
     atgttgtcat tttgtccgta ttgtgctaat atgttaataa tggctcagaa agatgatggg        60
     tgtaacaggt ttttctgtct gacatgcccc tacgagttta agatcgacgg attccaaatg       120
     tatgatcgta agaagttatc gagaaaagaa gttgatgatg ttttaggtgg tgaaggagct       180
     tgggataatg ttgaccagac attagcacaa tgtcctattg actcatgtgg tggggataag       240
     gcatattttt ttcaacttca aatcaggtct gccgatgagc ctatgaccac attctataag       300
     tgcgttaaat gttcccacca atggagagaa aactga                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page