(data stored in ACNUC6288 zone)

EMBL: CR382138.PE283

CR382138.PE283       Location/Qualifiers
FT   CDS_pept        580491..582863
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F06578g"
FT                   /old_locus_tag="DEHA0F07238g"
FT                   /old_locus_tag="DEHA-IPF8550"
FT                   /old_locus_tag="DEHA-CDS0866.1"
FT                   /product="DEHA2F06578p"
FT                   /note="weakly similar to uniprot|P32833 Saccharomyces
FT                   cerevisiae YBR060C ORC2 Subunit of the origin recognition
FT                   complex which directs DNA replication by binding to
FT                   replication origins and is also involved in transcriptional
FT                   silencing"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F06578g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88976"
FT                   /db_xref="GOA:Q6BMC7"
FT                   /db_xref="InterPro:IPR007220"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMC7"
FT                   /protein_id="CAG88976.2"
FT                   /translation="MTFEEKSSPENKGFNDSDIFLTPSKKHVSLSATPSHRQSPFDLTL
FT                   SPNKSPSKRGVIKLEKTADDIVLFSPVKTPNGRAGLPSPKKRTIAELDKSARKRAISTS
FT                   GIYSKLMDDDLEENNNEYLDRQEVSLAEAIIKESRDNKQEDVDEYFRAYGSDVELEEDL
FT                   TVNKKPKRRGRKPKKEVKVEEDDEIDDEDIEIEDDGELEDDDDEEFKLPKKERKAKNKR
FT                   IIREVSDIDDISEEDEAEKEILPKRQKITASPFAVTSVDEAISPSKRKVGRPSKASKVI
FT                   GKIKSIFQMDDEAFFTENKQATNRIKENADTSDVTKDSDSFFSMTLDNVTQSSIVSVPT
FT                   VSGIPNTKEGKRKVEVATVDSNKFIPLPIPNINEEGEIEDEEYVKKYLPNVNIEEKYSG
FT                   RLIDERAFFLDGTEGYFEQHMGRPKASANSLSQLAPPLEYDEFIPYVELSKLIRSKEKN
FT                   KLNDLHKSLYHQWCFELTCGFSLNFYGVGSKIKLIGDFVQNYLVDWYEQNMQEDEEYPD
FT                   ILVVNGYNPAVKFKKVAHDILSVFISQEKKKQDNVKFPKHISETIPFLMKYVEDRRVHR
FT                   PGQFIKPKLILVIHNIDGKPFLNERTQSLLSQLCSIPEIWLISSTDNINVSLLWDSFKL
FT                   KSFNFLWHDLTTYEPYTVEMSFRDVLSMGKSKKFVGNKGAKYVLSSLTKNARNLYKILL
FT                   TKQLEIMRNTTTTKAGRNGLKGSIKLGIEFKQLYNTCLEEFVTSNEISFRTMLGEFVEH
FT                   KMCSAVKDEAGVEMVFVPFNFDEMEKLLAEEFASNEM"
     atgacttttg aagagaaaag ttcacctgag aataagggat tcaatgattc cgacatattt        60
     ttgacgcctt caaagaagca tgttagtctc tccgcaacac cttcgcatcg tcaatcaccc       120
     tttgatttga cactttcacc taataaatcg cccagtaaaa gaggtgtaat aaagttagag       180
     aaaacagcag atgacatagt tttattttca ccagtaaaaa ctcccaatgg tagggctggt       240
     ttaccgtcac ctaaaaagag aacaatagca gaattggata agtcggcaag gaaaagggcc       300
     atactgacga gtggtatata ttccaagttg atggatgatg atttggagga aaataataat       360
     gaatacctag acaggcagga agtatcgttg gcagaggcaa tcataaaaga atctagagat       420
     aataaacagg aagatgtaga tgaatatttt agggcctacg gtagtgatgt agaattggag       480
     gaggatttaa ccgtcaataa aaagcctaag cgtagaggaa gaaagcctaa gaaggaagta       540
     aaagttgaag aggatgatga aatagatgac gaagatatcg aaatagaaga tgacggagaa       600
     ttagaagatg acgacgacga agaattcaag cttccaaaga aagaaaggaa agcaaaaaat       660
     aagcgcataa taagggaagt gagtgatata gatgatattt cagaggaaga tgaagcagaa       720
     aaggaaattt tacccaagag acaaaagata actgcgagcc catttgcagt tactctggta       780
     gatgaggcta tatctcctag taagaggaag gttggaagac ctagcaaagc aagtaaagtg       840
     attggtaaaa ttaaaagtat ttttcaaatg gacgatgaag catttttcac ggagaataaa       900
     caagctacga atagaattaa ggaaaatgcc gacactagtg atgttactaa agattcggac       960
     tccttctttt caatgacttt agataatgta acgcagagca gtattgtttc tgtgccaaca      1020
     gtaagtggta taccgaacac taaggaaggt aaaagaaagg tagaagtggc gactgtcgat      1080
     tcaaataaat tcattccatt accaatacct aacataaacg aagaaggaga aattgaagac      1140
     gaagaatacg ttaaaaaata tctacctaat gtgaatatag aagaaaaata ttcaggtagg      1200
     cttatcgacg aacgagcttt tttccttgat ggaactgaag gttatttcga acaacatatg      1260
     ggtagaccga aagctagtgc taactcatta tcacaattag cgcctccatt agaatacgat      1320
     gagtttatac catatgtcga attgagtaaa ttgatacgtt caaaggagaa gaataaacta      1380
     aacgacttac acaaatcatt ataccatcaa tggtgttttg aattaacttg cggatttagc      1440
     ttgaatttct atggcgttgg atcaaaaatt aaattaattg gcgactttgt tcaaaattat      1500
     cttgttgatt ggtacgagca aaatatgcaa gaggatgagg agtatccgga tatattggtt      1560
     gtaaatggat ataatcctgc ggtgaagttt aagaaagtag cccatgacat tttgtcggta      1620
     tttatctccc aggaaaaaaa gaaacaggac aatgtgaagt ttcccaagca tatatctgaa      1680
     acgattccat ttcttatgaa atatgtcgaa gatcgtcgtg tccatcggcc aggtcaattc      1740
     attaagccta agttgatatt ggttattcac aatattgatg gtaaaccctt tcttaatgaa      1800
     agaacccaaa gtttactctc tcaattatgc tctattccag agatatggct aatttcttct      1860
     actgacaaca taaacgtctc cttactttgg gatctgttca aattgaaaag tttcaacttt      1920
     ttatggcacg atttgacaac atacgagcct tacacagttg agatgtcttt tagagacgtt      1980
     ttgagtatgg gcaaatcgaa gaagttcgtc ggcaacaaag gtgccaagta tgtcttgagt      2040
     tcacttacga agaatgctag aaatctctac aaaatattgc ttaccaaaca gttggaaatt      2100
     atgagaaata ccactactac taaggcaggt cgtaatggcc taaaaggttc tataaagctt      2160
     ggtatcgagt tcaaacaact ttacaataca tgtttagaag aattcgttac ttcaaatgaa      2220
     ataagtttca gaactatgct tggagagttc gtcgaacaca agatgtgtag tgccgttaaa      2280
     gatgaagctg gtgtggaaat ggtattcgtc cctttcaact tcgacgaaat ggaaaagttg      2340
     cttgccgaag aatttgcatc taatgaaatg taa                                   2373
//

If you have problems or comments...

PBIL Back to PBIL home page