(data stored in ACNUC6288 zone)

EMBL: CR382138.PE284

CR382138.PE284       Location/Qualifiers
FT   CDS_pept        583031..586042
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F06600g"
FT                   /old_locus_tag="DEHA0F07260g"
FT                   /old_locus_tag="DEHA-IPF8547"
FT                   /old_locus_tag="DEHA-CDS0467.1"
FT                   /product="DEHA2F06600p"
FT                   /note="weakly similar to uniprot|P38080 Saccharomyces
FT                   cerevisiae YBR059C AKL1 Serine-threonine protein kinase
FT                   member (with Ark1p and Prk1p) of the Ark kinase family"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F06600g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88977"
FT                   /db_xref="GOA:Q6BMC6"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMC6"
FT                   /protein_id="CAG88977.2"
FT                   /translation="MGNFPKLPEGTQLPVGGHQVTILKYLSEGGFAHIYKVKIDPKEED
FT                   TDIACLKRVIVPDKNGLDQLRKEVDVMKNLRYGRNIVKYYDSHAARLENGTYQVLVLME
FT                   LCPNKSLLDYMNVKIKTKLTEPEILKIMSDISIGIYEMHKMKLVHRDIKIENVLIDAKN
FT                   DFKLCDFGSTSSPIMPPKDQQQFQLLSHDIMYQTTPQYRAPEMIDLYRGFPIDEKADIW
FT                   ALGCFLYKLCYYTTPFEANGDIAILHATFQFLPAPVFSGDLKNLIIIMLQENPLFRPNI
FT                   VQVLMLLCTMMKIEFKSLKLEDIYNTGPYNFHALHEYQRHKQNELLKQQQLYYQQNAYA
FT                   NGGKATSEVNLAKHYGNQIRSQNQSPFIRSQGGTPSQAYGQLNASNTADLQHQTQAELP
FT                   AALSHDLEPQKNKQEAGVTSPNNEVNSETEDDNTSEIGLENLDNVEERYPSLEDLLEDP
FT                   TKRTKSIDSDRVSQKDNAPPNLPNQNIRQPNMQNYGPQVPTQPVILSNADLQKLTPDQF
FT                   QQYHYQHQAYQYQLDQYQKQLYQQNEQQKHQQANALNPNSIDHNITTGKSKEPSEFEKK
FT                   EAWERHHSKIEKDAELLVDDIFATNSKSPALAPVQVQNTNQSAKGDIESLSKLKKSVSS
FT                   EYPSTSSDGHSKQHGEICAEDSIEPSIGAHNAQDAAGVFNDDGKEISSRSRHSLDGHNL
FT                   RPEGGHDQRDVFINDASNKVNDVDSFESFSGKYPDILSNMHIDAPFNSSPQTKVSNNSN
FT                   IPSINSSSTAAKYPFTYQQPSQQNVAYSNPKPDVNANKSDIRKHANPWGDYTKNANVAP
FT                   VKRVSSHSGIVNSQPASISNEPAPIIPVHEQMNALSLKERPSSMQQRGNSNEQSSEANL
FT                   IDLEVGLESSSSSTNTPALNPKTKDLYKLNTESSLSGFDLDDEKKPSESKHQFKKRLSS
FT                   AQNPSSFSFQEEVIDFASDDENPENSSEMNRLSIRNSLSKKPKSRKSSEHKRSDSANSE
FT                   GKKRLSLFGSSQGN"
     atggggaatt ttccgaaact tcccgaagga acgcagcttc cggtgggagg ccatcaagta        60
     acaattctta agtatctttc ggaaggaggg tttgcacata tttacaaagt aaaaattgat       120
     cctaaggagg aagatacaga tattgcttgc ttgaagagag ttatagtacc agataagaat       180
     ggattagatc aattaagaaa agaagttgat gtcatgaaaa acttgcgtta tggcaggaat       240
     atagtgaaat attacgattc gcatgcagca aggctagaga atggaacgta ccaagtattg       300
     gtacttatgg agctttgtcc taacaagtct ttgttggact atatgaatgt taaaatcaag       360
     accaaattaa ctgaaccaga aatcttgaaa attatgctgg acatatccat tggtatatac       420
     gaaatgcata agatgaaatt agttcatagg gatattaaga ttgaaaatgt tcttattgat       480
     gccaagaatg atttcaagct atgtgatttt ggctctactt cctcgccaat aatgccacca       540
     aaagatcaac agcaattcca acttctaagt catgatataa tgtatcagac tacaccccag       600
     tatagagcac cagagatgat agatttgtat agaggatttc ctattgacga gaaagcagat       660
     atttgggcgt tgggatgctt tttgtataag ttatgttatt atactacacc gtttgaggcg       720
     aatggcgata ttgctatcct tcacgcaact tttcaatttt taccagcacc tgttttctct       780
     ggtgacttga aaaacttaat cataataatg ctccaggaga atccactctt cagacctaat       840
     attgttcaag ttttgatgtt attatgcaca atgatgaaaa ttgaatttaa gagtctcaaa       900
     ctagaggaca tttataatac tggaccatat aatttccatg ctttacatga atatcaacgc       960
     cacaagcaaa atgagcttct caaacagcaa caactatatt atcaacagaa tgcatacgcg      1020
     aatggaggta aggctacctc ggaggttaat ttagccaagc actatggtaa tcaaataaga      1080
     ctgcaaaatc aatctccatt tattcgttct caaggaggta caccatcaca agcatacggc      1140
     caattgaatg cctcaaacac ggctgatttg caacatcaaa cacaagctga gttaccagcc      1200
     gcattatctc acgatttaga gcctcaaaag aataaacaag aagccggagt aaccctgcct      1260
     aataatgagg ttaattctga aacggaagat gataatacaa gtgaaatagg actagaaaat      1320
     ttggataatg tcgaagagag atatccttcc cttgaggatc ttttggaaga cccaactaag      1380
     agaactaagt caatagattc agatcgtgtt agtcaaaagg ataatgctcc acctaattta      1440
     cctaatcaga atattagaca accgaatatg cagaattatg gccctcaggt tcctacacag      1500
     ccagttatat taagtaatgc tgatcttcaa aaattgacac cggatcagtt tcaacaatat      1560
     cattaccagc atcaagctta tcaatatcag cttgaccaat atcagaaaca attataccaa      1620
     cagaatgagc aacaaaaaca ccaacaagca aatgctttaa acccgaatag tatagaccac      1680
     aatataacaa caggaaagtc aaaggaacca tctgagtttg agaaaaagga ggcatgggag      1740
     agacatcatt ctaagattga aaaagatgca gaactattgg ttgacgatat attcgccaca      1800
     aattccaaat ctccagcttt ggcacctgtg caagttcaaa atacgaacca aagtgcaaag      1860
     ggtgatatcg agtcattgtc gaagttgaag aaaagtgtat catctgaata tccttcaaca      1920
     agttcagatg gtcatctgaa acagcatgga gaaatttgtg cagaagatag tatagaacca      1980
     tctatcggtg cgcataatgc acaagatgcg gctggagttt tcaatgatga tgggaaagaa      2040
     atcagtagta gaagtagaca ttcattggat ggtcataatt tgagacctga agggggacac      2100
     gatcagcgtg atgtgtttat taatgatgcg tctaataaag ttaatgatgt tgactctttt      2160
     gaaagttttt ctggaaaata cccagatata cttagtaaca tgcacattga tgcgccattt      2220
     aacagcagtc ctcaaacaaa agtaagcaac aatctgaata taccctcaat taattctagt      2280
     tctactgcgg caaagtatcc ttttacatac cagcaacctt cacagcagaa tgtcgcatat      2340
     tcaaacccga aacccgatgt taatgccaac aaaagtgata ttaggaagca tgcaaatcca      2400
     tggggcgact ataccaagaa tgctaatgta gcaccagtca aaagggtgtc ttctcactcg      2460
     ggaatagtca attctcaacc tgcgtcaatt agtaatgagc cagcacctat aattcctgtt      2520
     catgaacaaa tgaatgcatt gtctttgaaa gaaagaccta gtagcatgca gcaaaggggt      2580
     aattcaaatg aacaatcctc cgaagccaat ttaattgatt tagaggttgg attagaatcg      2640
     tctagctcat ccaccaatac accggctctt aatcctaaaa ctaaggattt atataaattg      2700
     aatacggagt catctttgtc tggtttcgac cttgatgatg aaaagaaacc atcagagtcc      2760
     aagcatcagt tcaagaaaag actttcctcg gcgcaaaatc catccagctt cagctttcaa      2820
     gaagaagtca tcgattttgc atccgatgac gaaaatccgg agaacagttc tgaaatgaac      2880
     aggttgtcta taagaaattc tttatcaaag aaaccaaaat ctaggaaatc tagtgaacat      2940
     aagagatctg atagtgcaaa cagtgagggc aaaaagagat tgtcattatt tggttcttca      3000
     cagggtaatt aa                                                          3012
//

If you have problems or comments...

PBIL Back to PBIL home page