(data stored in ACNUC6288 zone)

EMBL: CR382138.PE288

CR382138.PE288       Location/Qualifiers
FT   CDS_pept        591421..592356
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F06688g"
FT                   /old_locus_tag="IPF_8536"
FT                   /product="DEHA2F06688p"
FT                   /note="weakly similar to uniprot|P46963 Saccharomyces
FT                   cerevisiae YML112W CTK3 Gamma subunit of C-terminal domain
FT                   kinase I (CTDK-I) which phosphorylates the C-terminal
FT                   repeated domain of the RNA polymerase II large subunit
FT                   (Rpo21p) to affect both transcription and pre-mRNA 3' end
FT                   processing"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F06688g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66286"
FT                   /db_xref="GOA:B5RUA8"
FT                   /db_xref="InterPro:IPR006569"
FT                   /db_xref="InterPro:IPR024637"
FT                   /db_xref="InterPro:IPR024638"
FT                   /db_xref="InterPro:IPR042326"
FT                   /db_xref="UniProtKB/TrEMBL:B5RUA8"
FT                   /protein_id="CAR66286.1"
FT                   /translation="MDSFEASTQFTQILKGLTPSIQNLTRAAHFALKNSESEDYLFHTI
FT                   IDTLDDPNIELNTKSTIFQFIEVLMHESLVISSQPKSHYTYPYVHNLKNSLPKILLKVL
FT                   PGSNNSSLYNAYNSLKNISETCKVNYDEYNKKYSGISELFTDEDLENIDTNLPFPDIKV
FT                   EDEIEASDPLITTWDLLIKKKKQSQYERLRLLKHSRMIEESVEEEDMFSYKGGKSQKDQ
FT                   NNGKANELLLSKKHILLRMEDDRETHKRSKENIWVVNRPKDASILTEDEFLVHYWNKYR
FT                   VMAEEEEKTFMDSLDELNGLVVESYKDKQF"
     atggattcgt tcgaagctag tacacaattc acacaaatac ttaaggggtt aacaccctcc        60
     attcaaaatt tgactcgagc agcacacttt gcattaaaaa attcagaaag tgaagattat       120
     ttgttccata cgatcataga cactttagat gacccaaaca tagagctaaa caccaagtcg       180
     acgatttttc aatttataga agtattaatg catgaatcat tggttatatc actgcaacca       240
     aaatcccact atacgtatcc gtatgtgcat aacttgaaaa attctctacc caaaatttta       300
     ctcaaggtat tacctgggtc aaacaattca agtttataca acgcctataa tagtttgaag       360
     aatatatctg aaacatgtaa ggttaattat gatgaataca acaaaaagta cagtggtata       420
     tccgagttat ttacagatga agatttagag aacatcgaca ccaatttacc gtttcctgac       480
     atcaaagtgg aagatgagat tgaagcgtca gatccattaa taactacgtg ggatttgtta       540
     atcaaaaaga aaaaacagag tcaatacgag agattgcggt tgttaaaaca cctgagaatg       600
     attgaagaat ccgtagagga ggaggacatg tttagttata agggaggcaa gtcacaaaaa       660
     gaccaaaata acggcaaagc aaatgaactt ttactctcaa agaaacatat tttgttaaga       720
     atggaagatg acagagagac ccataagaga tcaaaagaaa atatatgggt tgtaaataga       780
     ccaaaggatg cttctatttt aacggaagat gaattcttgg ttcattattg gaataaatat       840
     agagtgatgg cagaggaaga agagaagaca tttatggaca gccttgacga actcaacggc       900
     ttggtggttg aaagttataa agataagcag ttttag                                 936
//

If you have problems or comments...

PBIL Back to PBIL home page