(data stored in ACNUC6288 zone)

EMBL: CR382138.PE293

CR382138.PE293       Location/Qualifiers
FT   CDS_pept        complement(join(599762..600746,600811..600833))
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F06798g"
FT                   /product="DEHA2F06798p"
FT                   /note="highly similar to Candida albicans Q5ADU3 Potential
FT                   translation initiation factor eIF3-gamma-p40 subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F06798g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88987"
FT                   /db_xref="GOA:Q6BMB6"
FT                   /db_xref="InterPro:IPR027524"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BMB6"
FT                   /protein_id="CAG88987.1"
FT                   /translation="MNMATKQVKSYQAPTTTSIDVESSVVLSLIRHTSEHYPSLYSGAL
FT                   LGFESDSGALDITHAFAYPYPDQYEGGSLRSRSGAKYQQDILDSLKKLGYGIGFQGWFQ
FT                   STVSGNFVTTQLVDALVQQQLTNKNSFILIHNMASIGKELDLKAIRLSESFVRTYLDGK
FT                   WKSKDLENHKLSFLNIFDEIPIRIRNQHLVNLYLASSTNDTKSENEFDILNLSSNQNVT
FT                   AQLLESLYGQVDAYNYDQTNYNYYQRQHQKEQSKIMQWKQQRKLDNLERAKIGEKELDT
FT                   EEWQSLFKLPTEPSRYNNMLHSHAIDVLADDILKRCDEDLTKSFAIERKLTTDK"
     atgaatatgg ctactaagca agtaaaatca taccaagcgc caacaacaac atcaattgat        60
     gttgaatcaa gcgttgtctt atcattgatc agacatacat cagaacacta tccatcatta       120
     tattcaggag ctttgttagg atttgaatca gacagtggtg cattagatat cacccatgct       180
     tttgcatacc catatccaga tcagtacgag ggagggtctt tacgttcaag aagtggagct       240
     aaataccaac aagatatatt ggactcgtta aagaagttag gatatggtat tggcttccaa       300
     gggtggtttc aatctactgt ttccggtaat tttgttacca cacaattggt tgatgcgtta       360
     gttcaacaac aattgaccaa caagaactca tttattttaa ttcacaatat ggcttccatc       420
     ggaaaggaat tggacttgaa ggctataaga ttatcagaga gttttgtcag aacttactta       480
     gacggtaagt ggaaatcaaa ggatttagaa aatcacaaat tatcgttctt gaatatcttc       540
     gacgagattc caattagaat ccgtaaccaa catttggtca acttatactt ggcatcctcc       600
     accaatgata ccaaatctga aaatgaattt gatatcttaa acttatcttc caaccaaaat       660
     gttactgccc aattattaga atccttatac ggccaagtag atgcatacaa ttacgaccaa       720
     accaactaca attactacca aagacaacat caaaaagagc aaagtaaaat tatgcaatgg       780
     aagcaacaaa gaaagttgga caacttggaa agagctaaga tcggcgaaaa ggaattagac       840
     accgaagaat ggcaatcctt atttaagttg cctactgaac catcaagata caataacatg       900
     ttacactctc acgctataga tgtattagct gatgatatct tgaagagatg cgacgaagac       960
     ttaacaaaga gctttgcgat cgaaagaaaa ttgactactg acaaatag                   1008
//

If you have problems or comments...

PBIL Back to PBIL home page