(data stored in ACNUC6288 zone)

EMBL: CR382138.PE296

CR382138.PE296       Location/Qualifiers
FT   CDS_pept        604086..604889
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F06864g"
FT                   /old_locus_tag="DEHA0F07546g"
FT                   /old_locus_tag="DEHA-IPF8526"
FT                   /old_locus_tag="DEHA-CDS4472.1"
FT                   /product="DEHA2F06864p"
FT                   /note="weakly similar to uniprot|Q03201 Saccharomyces
FT                   cerevisiae YDR041W RSM10 Mitochondrial ribosomal protein of
FT                   the small subunit has similarity to E. coli S10 ribosomal
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F06864g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88990"
FT                   /db_xref="GOA:Q6BMB3"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BMB3"
FT                   /protein_id="CAG88990.1"
FT                   /translation="MLSRILGVRNHSFRAFSTIGVCYNKSNTSPKKYLSPNEFASQKQV
FT                   DEIEEQAYKQNLLNEEYKYDPKYLSENELNPISKRPIPLNVELLKYKPVQLPPTHGHEV
FT                   AKIEFKGYDKDDLIRASEFAARAAFYLGIPCSKVQSLKTEKRLYTVIKSPFAQAKSKEN
FT                   FKRTTYGRKVYAYDATPEVVDLWLSFINKHAIEGVKYNALIHTRESLDFCEKLDALSAD
FT                   DMHMPDAYKGSDDPIANKVEELLKSDTFKKYFDEANIAESPKESK"
     atgttaagtc gtatattagg agtgcgtaat cactcatttc gtgctttttc tactattgga        60
     gtatgttata acaagtcaaa tacttcacca aagaaatatt tatcaccaaa cgaatttgct       120
     tctcaaaagc aagttgacga aatagaagaa caagcataca aacagaattt gttgaatgag       180
     gaatataagt acgatcccaa atatttgtct gaaaatgaat taaatcctat ttctaagaga       240
     cctatcccat taaatgttga attattaaaa tataaacctg tacaattacc tccaacacat       300
     ggacatgagg tcgccaaaat tgaatttaaa ggatacgaca aagacgatct tattagagca       360
     tctgagttcg ctgcaagagc tgcattttac ttggggatcc catgttcgaa ggttcaatcc       420
     cttaaaaccg aaaagagatt atatactgtt atcaagtctc cttttgctca agctaaatcg       480
     aaagaaaatt ttaaaagaac tacctacgga agaaaggtat atgcatatga tgcgacacca       540
     gaagttgtag atttgtggtt atcgtttatt aataagcacg ctattgaagg agtcaaatat       600
     aatgcattaa ttcacaccag agaatcgtta gatttctgtg agaaattgga tgctttatcc       660
     gccgacgata tgcacatgcc tgatgcttat aaaggatctg acgatccaat tgctaataag       720
     gtagaagagt tattaaaatc ggatacattt aagaaatact tcgatgaagc taatattgct       780
     gaatccccaa aagaatctaa ataa                                              804
//

If you have problems or comments...

PBIL Back to PBIL home page