(data stored in ACNUC6288 zone)

EMBL: CR382138.PE316

CR382138.PE316       Location/Qualifiers
FT   CDS_pept        complement(639187..639996)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F07370g"
FT                   /old_locus_tag="DEHA0F08184g"
FT                   /old_locus_tag="DEHA-IPF8487"
FT                   /old_locus_tag="DEHA-CDS4593.1"
FT                   /product="DEHA2F07370p"
FT                   /note="similar to uniprot|P29478 Saccharomyces cerevisiae
FT                   YML105C SEC65 signal recognition particle subunit homologue
FT                   of mammalian SRP19"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F07370g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89015"
FT                   /db_xref="GOA:Q6BM93"
FT                   /db_xref="InterPro:IPR002778"
FT                   /db_xref="InterPro:IPR036521"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BM93"
FT                   /protein_id="CAG89015.1"
FT                   /translation="MAKRPVLEDVLDDEIDNMDMDIAQFDPSLRTPIAPVQPGPQITRS
FT                   QDQEPPLFPNFPHPEQDKSVERKDIVDPNKFSAEERAELKKFQIIYPCYFDKSRSHKDG
FT                   RRVSESKAVSNPLAKTISDACRHYNLPVMLELDKTHPQDFGNPGRVRVLIKDNNKNGMP
FT                   VDSRFKTKRAVLNIIADYLKTHPTTLASIGPKSGIPLPSEYETGFEPGEIPKVKGFKMN
FT                   TIVPVHSELTIKHPMTKSIYDPEPEQPQVKAPQAPKQPKKKVMKIRG"
     atggcaaaga gaccagtatt ggaagacgtc ttggatgatg agattgataa catggacatg        60
     gatattgccc aatttgatcc atcactcaga actccaatag caccagtaca accaggacct       120
     caaattacaa gatcacaaga tcaagaacca ccattatttc ctaatttccc acacccagag       180
     caagacaaga gtgttgagcg taaagatatt gttgatccta acaagttttc tgcggaggaa       240
     agagctgaat taaaaaaatt tcaaataatc tatccatgtt actttgataa atcaagatcg       300
     cataaggacg gaagaagagt atcagagtct aaagcagtgt cgaatccatt agcaaagact       360
     atatcagatg cgtgtcgtca ttataattta ccagtaatgt tggaattaga taagacacat       420
     ccgcaagact tcggtaatcc aggtagagta agagtattaa tcaaagacaa caataaaaat       480
     ggtatgccag tcgattcgag atttaagact aaaagagcag tattaaatat catagctgac       540
     tacttgaaaa cgcatccaac tacgttagct agcattggac caaagagtgg tattccatta       600
     ccaagtgaat atgagaccgg tttcgaaccg ggtgaaatac ctaaggtcaa agggttcaaa       660
     atgaatacta ttgtacctgt tcattctgag ttgactatca agcacccaat gacaaagagt       720
     atttatgatc ctgaaccaga gcagccacag gttaaagctc cacaagcacc taaacaacca       780
     aaaaagaagg ttatgaagat tagaggttaa                                        810
//

If you have problems or comments...

PBIL Back to PBIL home page