(data stored in ACNUC6288 zone)

EMBL: CR382138.PE321

CR382138.PE321       Location/Qualifiers
FT   CDS_pept        650336..653902
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F07480g"
FT                   /old_locus_tag="DEHA0F08294g"
FT                   /old_locus_tag="DEHA-IPF8478"
FT                   /old_locus_tag="DEHA-CDS0244.1"
FT                   /product="DEHA2F07480p"
FT                   /note="weakly similar to uniprot|Q01846 Saccharomyces
FT                   cerevisiae YML104C MDM1 Intermediate filament protein
FT                   required for nuclear and mitochondrial transmission to
FT                   daughter buds"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F07480g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89020"
FT                   /db_xref="GOA:Q6BM88"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="InterPro:IPR003114"
FT                   /db_xref="InterPro:IPR013937"
FT                   /db_xref="InterPro:IPR016137"
FT                   /db_xref="InterPro:IPR036305"
FT                   /db_xref="InterPro:IPR036871"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BM88"
FT                   /protein_id="CAG89020.2"
FT                   /translation="MSMNNDVQLSFQTKHGIIFRIGTWLATIFVITFITRYTLKYWISI
FT                   LFGFLTCISIAFYLIIGDSSVKPIPNYSKKSTRFSFVDEEKWSHELHKLYKDTRMLNEP
FT                   VIEQSFLISETLEDFINLIIKEFIDSWFVQISNSTVFQDSIRQELKYVIRNLHERFTQL
FT                   DFAKLLVFRILPIIHDHFNHFVKIQHGIRLNGNTSKLPTGSMEYAIAAARQYDRGKVHP
FT                   GVTVSMNSNDVNEKKHLRNKVDSILPHLLSPEENTNKAGTSLVKEIISCTILSRVIHLL
FT                   GDGDFYNLLIVNLIGDNIKHREQVKQLRAALEEHTRSLKRQTSKGISMTASSEYLQNYK
FT                   RINKNSTIQKNMDNHSFNEALQCVSKVSSVAELKHLSSYTGFQLSRVKDENPGSSKEIN
FT                   VLLSRLNLLKSKIDNKLAQLSITSEKKIHKDEDAANLTLLDILNNSVGLKFFTEFMNDR
FT                   SRSQLFQLWLAIDEIRAPLEDIDIEEDGEARLSLSLEFSNLGDIVEIYREFFQNSSLEI
FT                   DRDVFNRVESFVNNKDPIYKLELYQKSRKALFKLQNNIYESISNDDFPPFKKSELFLKL
FT                   LETHIFDSKPDEINSPMSWSSSGKRKIKQISDPLEDSSESEADEVSPGVIKAVEDAFTQ
FT                   IMNSSDDKKSEIISDSKNSNSRSSSADIAESTSNNPISTIHLKKDLFGESSNLFTDDSV
FT                   NFSNGNRNSKLFDDISDHSFSDSDSINFDSDSQNQNINLSNPSHSDSQIFLAAPGNLRL
FT                   AEEISKLSEEIDKLSEQQAVLSPLLKKAELTNNVGELKILRKSKVSLDREINAKELQKQ
FT                   QFIVQENDNSLYGKSRVSIQSYISNNENGKNYILYIVEVQKLSSENQNNVTAGWIVARR
FT                   FSQFFRLNEYLKSRYPLVVNIKFPKRTVSVLKFQQKQIVEQRKALLEEYLQQLLKIPEV
FT                   CSNKVFRSFLSSENFTSRNSQSIDGNTNVNLSKLRNSVEIVANKLYNGISGKISSNSLS
FT                   NADKSFPLPDQPMEKYMKDMQKELRQFDESEHTNSIEKPVFVKPVCDLLISVFRLNTPK
FT                   SWLRGRALLVILHQVFGNTLEKKAYEVIDFFLRTEENVLDLLIWGKNIIFPMGRLMEPP
FT                   EPRNSYQRSTTKQEAKALLEIFMQETCSKIFGLANTTYACNNIFELLQNGFLNKHLILQ
FT                   IFDEIINQLFPEASTDVSSVSV"
     atgtcaatga ataatgacgt gcaattgtca tttcaaacca aacacgggat aatatttcgt        60
     attggaacct ggttagcaac gatttttgtc attactttca ttaccaggta taccttaaaa       120
     tactggatac tgattttatt tgggtttctt acttgcattt ctattgcttt ttatttgata       180
     attggggatt cctctgtcaa acctattccg aattatagta aaaagtcaac acgattcagt       240
     tttgttgatg aagaaaagtg gagccatgaa cttcataaac tttataaaga tactaggatg       300
     cttaatgaac cagtaattga gcaatcattt ctaatatctg aaactcttga agactttatt       360
     aatttgatta ttaaggaatt tatagacagc tggtttgtac aaatttcgaa cagtactgtt       420
     tttcaagata gtattagaca ggaattaaag tatgttatac gaaacttaca cgagaggttt       480
     acccaacttg actttgctaa gctattagtg tttcgaatct tgcctataat tcatgatcat       540
     ttcaaccact ttgtcaaaat tcagcatggc attaggctaa acgggaatac ctccaaactt       600
     cccacgggat caatggaata tgccatcgca gctgcacgtc aatatgatag aggtaaagtg       660
     catccaggtg ttactgtttc aatgaattca aatgacgtta atgagaagaa acatctaagg       720
     aataaggtcg attcaattct tccacatctc ttatctccag aagaaaatac caataaggcg       780
     ggaacttcat tggtgaaaga aattatatcg tgtacgatat tatcaagggt gattcactta       840
     ttaggagatg gtgattttta taatctttta attgtgaacc ttatcggtga taatataaag       900
     catagggaac aagttaagca attacgggct gcattagaag aacatactag actgttaaaa       960
     cgccagactt caaaaggtat atcaatgact gcatcatctg aatatcttca gaattataaa      1020
     agaataaata aaaatagtac tatccagaaa aacatggata atcattcgtt taatgaagca      1080
     ttgcagtgtg tttctaaggt ttcaagtgtc gctgagttaa agcatttact gctgtatacg      1140
     ggttttcaat tatcaagagt caaggacgaa aatcctggat cgtccaaaga aattaatgtt      1200
     ttattgtcta ggctaaattt acttaaatct aaaattgata acaagttagc tcaactatca      1260
     attacatcag aaaagaaaat acataaggat gaagatgctg caaacttgac gttattggat      1320
     atattgaata acagtgtagg cttaaaattc ttcactgaat tcatgaatga cagaagtaga      1380
     tcacaattgt ttcagctttg gttggccata gatgaaatta gagctcctct tgaggatatt      1440
     gatattgagg aagatggaga agctcgctta tctctatctc ttgaattctc caatttagga      1500
     gatatcgtcg agatatacag ggagtttttt cagaattcaa gtctcgaaat tgatcgggac      1560
     gtgtttaaca gggtcgagag ttttgttaat aataaggatc ctatttacaa gttagaatta      1620
     taccagaaat ccagaaaggc gctcttcaag ctacagaata atatttatga aagcattagc      1680
     aacgatgatt ttccaccttt caagaaatca gaattgtttt taaaattact tgagacgcat      1740
     attttcgatt caaaaccaga tgaaattaat tcaccaatgt cgtggtcttc gtctggtaaa      1800
     cggaagatta aacaaataag cgacccctta gaagattcta gtgaaagcga agctgatgaa      1860
     gtcagtcctg gtgttatcaa ggctgtagaa gatgcgttca ctcagattat gaatagttct      1920
     gatgataaga agagtgaaat aatatccgat tcaaaaaact ctaacctgcg ttcctcttct      1980
     gcggacattg cagagtcaac ttcaaataat ccaattctga caatacattt aaaaaaagat      2040
     ttatttggtg aatcttctaa tttgtttaca gatgatagcg ttaacttctc aaatggcaat      2100
     agaaattcta aactatttga cgatataagt gaccattctt tctctgacag cgattcgata      2160
     aactttgatt cggactctca aaaccaaaat ataaatttac tgaacccttc acattcagac      2220
     ctgcaaatat ttttagcagc acccgggaac ctccgcttag cagaagaaat atctaaatta      2280
     agtgaagaaa ttgataaatt atcagagcag caggctgttt taagcccatt attgaaaaag      2340
     gcagagctca caaataacgt cggtgaatta aaaattttga ggaaatccaa agttagttta      2400
     gatagagaaa ttaatgcaaa ggaattacag aaacagcagt tcattgttca agaaaacgat      2460
     aacagtttgt atgggaaatc tcgggtaagc attcagtcat atattagtaa taatgaaaat      2520
     gggaagaatt atatcctcta tattgttgaa gtacaaaaat tatctagtga gaatcaaaac      2580
     aatgtcactg ctggatggat tgttgcaaga agattcagtc aatttttcag attaaatgaa      2640
     tacttaaagt ctagatatcc actagtagta aatataaaat ttcctaaaag aacagttctg      2700
     gttttaaagt ttcaacaaaa gcaaatagtc gaacaaagga aagccttact tgaagaatac      2760
     ttacagcagc tactaaaaat ccctgaagta tgttctaaca aagtattcag atcgtttcta      2820
     tcttctgaga acttcactct gagaaatagt caatctatcg acggaaatac taacgtcaat      2880
     ttgagtaaac taagaaacag tgtggagata gttgcaaata agctttataa cggtatctca      2940
     ggcaaaatat cactgaactc attaagtaat gcggataagt cttttccttt gcctgatcaa      3000
     ccaatggaaa agtatatgaa ggatatgcaa aaggagttga ggcagtttga cgagtcggag      3060
     cacacaaata gcatagaaaa gcctgttttc gttaagcctg tatgcgatct attgatatct      3120
     gtttttagac tcaatacgcc aaagagttgg ttacgaggca gggccctttt agtcatccta      3180
     caccaggtat ttggtaatac tctagagaaa aaagcatatg aggtgataga ctttttcttg      3240
     agaaccgaag aaaatgtgct tgatctatta atatggggta aaaacatcat atttcccatg      3300
     gggaggctta tggaaccacc agaaccgcga aactcgtatc agagatcaac gacaaaacaa      3360
     gaagctaaag ccctccttga aatattcatg caagaaactt gttccaaaat atttggctta      3420
     gcgaacacta catatgcatg caacaacata ttcgaattgc ttcagaatgg ttttctaaac      3480
     aagcatctaa ttttgcaaat tttcgacgag ataatcaacc aattgtttcc ggaagcatcc      3540
     accgatgttt catcggtttc tgtatag                                          3567
//

If you have problems or comments...

PBIL Back to PBIL home page