(data stored in ACNUC6288 zone)

EMBL: CR382138.PE322

CR382138.PE322       Location/Qualifiers
FT   CDS_pept        654096..654701
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F07502g"
FT                   /old_locus_tag="DEHA0F08316g"
FT                   /old_locus_tag="DEHA-IPF8476"
FT                   /old_locus_tag="DEHA-CDS5348.1"
FT                   /product="DEHA2F07502p"
FT                   /note="similar to uniprot|P43582 Saccharomyces cerevisiae
FT                   YFL010C WWM1 WW domain containing protein interacting with
FT                   Metacaspase (MCA1)"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F07502g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89021"
FT                   /db_xref="GOA:Q6BM87"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="InterPro:IPR036020"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BM87"
FT                   /protein_id="CAG89021.1"
FT                   /translation="MVTNDSKNTPNVPEGWLAKFDDKYNTFFYVNLKTKKSQWEAPSGT
FT                   SFEPKSADEVLPPPYSPTSSSGARAQYQTQDRPQAQPQVQSQPQPHVQQYPPQQGYPQG
FT                   YPPQGYGYPPQQGYPPQGYGYPPQQQYMQQKPQRSRMGGMGGLGMGLGGGMLGGMLLGN
FT                   MMGNNEMEAYHDGFQDGGMSGGDDMGGDMGGDMGGGDF"
     atggttacca atgattcaaa aaatacgcca aacgttccag aaggctggtt agccaaattc        60
     gatgataaat ataacacgtt tttctacgtc aacttaaaga ctaagaagtc acaatgggag       120
     gcaccttcag gcacatcatt cgagcctaag tctgctgatg aagtgttgcc acctccttac       180
     agtcctacat catctagtgg tgctcgagca caataccaaa ctcaggatag accacaagct       240
     caaccacaag ttcaatctca acctcaacct catgttcagc aatatcctcc acaacaagga       300
     tatccacagg gatatccacc ccagggatat ggataccccc cacaacaagg atatccaccc       360
     caaggatatg gatacccacc tcagcaacaa tacatgcaac agaaaccaca aaggtcccgt       420
     atggggggca tggggggctt aggcatgggt cttggtggtg gtatgcttgg tggtatgctt       480
     ttaggtaata tgatgggcaa caacgagatg gaagcatatc acgatgggtt tcaagatgga       540
     ggtatgagtg gtggtgatga tatgggtggt gacatgggtg gtgacatggg tggtggtgat       600
     ttctga                                                                  606
//

If you have problems or comments...

PBIL Back to PBIL home page