(data stored in ACNUC6288 zone)

EMBL: CR382138.PE327

CR382138.PE327       Location/Qualifiers
FT   CDS_pept        complement(659940..662840)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F07612g"
FT                   /old_locus_tag="IPF_8466"
FT                   /product="DEHA2F07612p"
FT                   /note="similar to uniprot|P43564 Saccharomyces cerevisiae
FT                   YFL034W Possible integral membrane protein that interacts
FT                   with Rpp0p which is a component of the ribosomal stalk"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F07612g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66292"
FT                   /db_xref="GOA:B5RUB4"
FT                   /db_xref="InterPro:IPR007941"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B5RUB4"
FT                   /protein_id="CAR66292.1"
FT                   /translation="MDFKRTPSVDSLGTAHSVYSSKTPTRSRSNIGSRTSISVLPSLPT
FT                   NVSNESIEEDLHNHSNIDEKLEREATPETSYVEFDLSSMDQKNSRNDSNFLSEKIISPN
FT                   THRTDISDVEADKDEVSDVAKKPEDAENDFFDMKTSDWKSMKTITEQDYYNDKGELEYK
FT                   HANEFDPSKIKFDAHGYTKIDTEEQVTKYAELDKKTDFLFQSRREINKKTEAAAYRKED
FT                   LDYASDEDNSEYEDDDNLDSNETLQTMRNMLTDGQKFAYVGTTKLIAIDMATELAKIKQ
FT                   STSNKVAKELSLGQRNFANWTMYITSKLYEHMNLSKDEQNMIENLSKHGVEVTDLCSSL
FT                   NQREIIKPSKQNQTQENETDDSMKEIKGKTDNNEVAVDLRWTIICDLLLLLLSDGYYDS
FT                   RSRSLLVQFAEKMSISHLEILQFERRLIESLEIDTNNKSIENKDEKLNDREFIDKYKKK
FT                   NKKKRYVYIGLATLGGSLAIGLSAGLLAPVIGLGIAGGLTTVGISGTSGFLAGVGGSAI
FT                   ITTGGIVTGAKVGSKAGARRLGDVNTFELKPLYNTKRTNLIITVSGWMNGKMDDVRLPF
FT                   STVDPVMGDMFSLLWEPEMLQSMGQTIGILATEALSTSIQQILGATVLSALMAAIQVPM
FT                   VLSKLTYLLDNPWSVSLDRAWKGGKILADTLISGNMGVRPITLVGFSLGARLIYSCLIE
FT                   LAKRGGYGLIENVIILGCPITIKNDQLGLARSVVSGRFVNGFSKRDWILGYLFRATGGG
FT                   ISSVAGLSPIESVYGIENIDCTDIVEGHMAYRKAMPKILKAVNWEILSEEFAEIEEPDP
FT                   EQHERERKLVDEFDEARAKMKEEMDTEANKKKTWKNFFKPNQKDWWNVYSEGKSKGSDA
FT                   NEPYADPSAESNQPHTQTNNPIFDVTALLEEANNIERLADNDPETLKTMRKEVDTSAKH
FT                   TKLNEEVEEEEKSTSIVNSLANKFGVKQDADPGTKD"
     atggatttta aacgcacacc aagcgtagat tcgctaggaa ccgcccattc agtgtacagc        60
     tctaagactc ctacaagatc aagatcaaac atcggatcaa gaactagcat atcggtattg       120
     cctagcttgc caacaaatgt ttcgaatgaa agtattgaag aagatttaca taaccactcc       180
     aatatagacg agaaactcga gcgtgaggca actccagaaa ccagttatgt ggaatttgac       240
     ctactgtcaa tggaccagaa aaatagcagg aacgattcca atttcttatc agagaagata       300
     atatcgccaa atactcatag aaccgatatc agtgatgtcg aagctgataa agatgaggta       360
     tcggatgttg caaagaaacc cgaggatgct gaaaatgact tctttgacat gaaaacatct       420
     gactggaaat caatgaaaac aattacagag caagattatt ataatgacaa aggtgaatta       480
     gaatataaac atgcaaatga attcgatcca tcgaagatca aatttgatgc tcacgggtac       540
     acgaagattg atacagaaga acaggttacc aaatatgctg agctagataa gaaaacagat       600
     ttcttgtttc aaagcaggag ggaaataaat aagaagacag aagcggcagc atatcgtaaa       660
     gaagacttag attatgcatc agacgaagat aactctgaat atgaggacga tgataacttg       720
     gattccaacg aaaccttaca aacaatgaga aacatgttga cagatggaca aaagtttgca       780
     tatgtcggta ccactaaact aatagcaatc gatatggcaa ctgagttggc aaaaattaaa       840
     caatcgactt ctaacaaagt agcgaaagaa ctaagtttag gtcagcggaa ctttgcaaat       900
     tggacgatgt atataacgtc caagttatat gagcatatga acttaagtaa agatgaacaa       960
     aatatgattg aaaatctaag caaacacggt gttgaagtta ctgacttatg cagtagtttg      1020
     aaccaaagag aaattatcaa accttccaag cagaatcaaa ctcaagagaa tgagacagac      1080
     gattcgatga aagaaataaa gggaaaaact gataataatg aggttgctgt cgatctaaga      1140
     tggacaataa tatgtgactt attgctatta ttgttaagcg atggttatta tgatagtaga      1200
     tcccggtcat tattagttca gtttgcagag aaaatgagta tttcacattt agaaatcctt      1260
     caattcgaac gtcgtttaat cgagagttta gaaattgata caaataataa atctattgaa      1320
     aataaggacg agaaattaaa tgatagagag ttcatagata aatacaagaa gaagaacaag      1380
     aaaaagagat atgtttatat tgggttagcc acattaggtg gatctcttgc gattggcctt      1440
     tcagctggat tattggcgcc agtcattggg ttgggtattg caggaggttt aacaacagtt      1500
     ggtatctcag gtactagtgg gttcttagct ggagttggtg gaagtgctat tatcacgaca      1560
     ggagggattg tgacgggtgc taaagtcggg tcaaaagcgg gtgcaagaag attaggcgat      1620
     gttaatacat ttgaacttaa accgttatac aatacaaaga gaacaaattt gattatcaca      1680
     gttagtgggt ggatgaatgg taagatggat gacgtaaggt tgcctttctc aacagtcgat      1740
     cctgtcatgg gtgatatgtt ttcccttcta tgggagcctg aaatgttaca gtctatgggt      1800
     caaactattg gtatattggc tactgaagct ttaagtacct ctatccagca aattctagga      1860
     gcaacagtgt tgtcggcatt aatggctgca atccaagtgc ctatggtttt atctaaattg      1920
     acgtacttac ttgataatcc ttggagtgta tcgttggaca gggcttggaa aggtggaaag      1980
     atattggcag acactttgat atctggtaat atgggtgtga gacctataac tctagtaggt      2040
     ttctcattag gtgcacgttt gatttattca tgtttaattg aattagctaa acgtggtgga      2100
     tatggattga ttgaaaacgt aattatatta ggctgtccaa tcacaattaa gaatgatcaa      2160
     cttggactag ctagatctgt cgttagtgga agatttgtta acggcttttc aaaaagagat      2220
     tggatcctag gctatttatt tagggctact ggaggcggta tcctgtcagt tgcgggctta      2280
     tcgccaatcg agagtgtata cggtatagaa aacatcgatt gcacagatat tgtggaagga      2340
     catatggcat atagaaaagc tatgcccaag attttaaaag cagttaactg ggaaatattg      2400
     agcgaagagt tcgccgaaat tgaagaaccc gatccagaac aacacgaaag agaaagaaag      2460
     ttggtcgatg aattcgacga agcaagggct aagatgaagg aagaaatgga tacagaagca      2520
     aacaagaaga agacttggaa gaatttcttc aagccaaacc aaaaggactg gtggaatgta      2580
     tacagtgaag gtaaatctaa aggttcagat gcaaatgaac catatgccga tccgtccgca      2640
     gaactgaacc agcctcatac tcagaccaat aatccaatct tcgatgttac tgctttactt      2700
     gaggaggcaa acaatattga acgtcttgct gataatgatc cagagacttt aaagactatg      2760
     aggaaggaag tcgatactag cgcaaagcat acaaagctca atgaggaagt cgaagaagag      2820
     gaaaaatcga caagcatagt gaattcatta gctaataaat tcggtgtcaa acaagatgct      2880
     gatcctggta ccaaagacta a                                                2901
//

If you have problems or comments...

PBIL Back to PBIL home page