(data stored in ACNUC6288 zone)

EMBL: CR382138.PE329

CR382138.PE329       Location/Qualifiers
FT   CDS_pept        complement(665238..666302)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F07656g"
FT                   /old_locus_tag="DEHA0F08481g"
FT                   /old_locus_tag="DEHA-IPF8462"
FT                   /old_locus_tag="DEHA-CDS3629.1"
FT                   /product="DEHA2F07656p"
FT                   /note="similar to uniprot|P53686 Saccharomyces cerevisiae
FT                   YPL015C HST2 Cytoplasmic member of the silencing
FT                   information regulator 2 (Sir2) family of NAD(+)-dependent
FT                   protein deacetylases"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F07656g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89029"
FT                   /db_xref="GOA:Q6BM81"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR017328"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BM81"
FT                   /protein_id="CAG89029.2"
FT                   /translation="MNQLTKILEPIAKAIQAGDKKVTFFEGAGISTAAGIPDFRSPDTG
FT                   LYSNLAKLDLPYAEAVFDIDYFKENPKAFYTLAHELYPGKFMPTKFHYLLRLFQDKKLL
FT                   KRVYTQNIDTLERVAGIEDEYIVEAHGSFARNHCIECSLEMSTEELKKQMSDKSVNDGI
FT                   PICQECGGYVKPDIVFFGEALPVKFFDTWDEDADEVEIAIVAGTSLTVYPFASLPSETT
FT                   KKSLRLLINNEVVGDFKHGKRKTDILAISDCDEAAVTLAELLGWSEELDELINKNKTLF
FT                   ESTYSIGEKTNDEEVSKKSLSKASERLAEEIRDVEAEKGTQKPEKTDKQTESKEEKSKN
FT                   DTDDLEKDISNLKI"
     atgaatcaac taacaaagat tttagaacca atagccaagg caatacaggc tggtgataag        60
     aaagtaacct tttttgaagg agctggtatc tccacagcag caggtattcc agattttaga       120
     agtccagata ctgggttata ctccaacttg gctaaattag acttgccata tgccgaggct       180
     gtttttgata ttgattactt taaggagaat ccaaaagcat tttatacatt agctcatgag       240
     ctttatccag ggaagtttat gcctacaaag tttcattact tgctaagact tttccaggat       300
     aagaagctat taaaacgagt ttatacgcaa aatattgaca ctttagagag agttgcaggt       360
     attgaggatg agtatatagt ggaagcacat ggttcattcg ccagaaatca ttgtattgag       420
     tgttcgctag aaatgtcaac agaagaattg aagaaacaaa tgtccgacaa actggttaac       480
     gatggtattc caatatgtca ggaatgtgga ggttatgtga agcccgatat agtttttttt       540
     ggtgaagcct tgccagtgaa attttttgat acgtgggacg aagatgcaga cgaagttgaa       600
     atagccatag tggctggtac atcattgacg gtatatccgt ttgcttcatt accatcggag       660
     accacaaaaa aatctcttag attacttatt aataatgaag tagtaggtga ttttaaacat       720
     ggaaagcgga agacggacat tttagctata tctgattgtg acgaagctgc agttaccttg       780
     gcagaattat tgggatggag tgaagagcta gacgagttga taaataagaa taaaactttg       840
     ttcgagagca catattctat tggtgaaaaa actaatgacg aggaagtttc taaaaaatct       900
     ttatccaagg catcagaaag attagccgaa gaaataagag acgttgaagc agagaaaggt       960
     acccaaaaac ctgagaagac agacaaacaa acagaatcaa aggaagagaa gtcaaagaat      1020
     gatactgatg accttgaaaa ggatatttcg aacttaaaga tctaa                      1065
//

If you have problems or comments...

PBIL Back to PBIL home page