(data stored in ACNUC6288 zone)

EMBL: CR382138.PE338

CR382138.PE338       Location/Qualifiers
FT   CDS_pept        join(681593..681595,681720..682721)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F07854g"
FT                   /old_locus_tag="DEHA0F08745g"
FT                   /product="DEHA2F07854p"
FT                   /note="weakly similar to uniprot|Q00916 Saccharomyces
FT                   cerevisiae YIL061C SNP1 U1snRNP 70K protein"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F07854g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89041"
FT                   /db_xref="GOA:Q6BM70"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR022023"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="InterPro:IPR040252"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BM70"
FT                   /protein_id="CAG89041.2"
FT                   /translation="MANETEKYPINIQKLFAVKPPLVYKTPLDYPAESRCTNHITSVSS
FT                   FRNQWQQYVDDLVEAEKNQPPPIETIQQVQIREKGRKKQELQKSYQLQLNEWNDPELLQ
FT                   KNEQEFMKDPFKTVFISRLDYLLTELDISKNFSKYGVIESITIVRDKKSGKSRGYGFVV
FT                   FERDEDAKGCIKELAPTGLKIPVENKPFTRTILVDMERGRLVRNWKPRRLGGGLGGRHY
FT                   TRPSPTLSNNASAAASGRRLHLSSNPYQSTPSQPSHSSTRYAPRPSAPRPMVENRQPRP
FT                   AAYGSYNSSVENNESVRDKYAKYSSNNDSNSSSYRSPRTSGQNRSIRSIRQRE"
     atggctaacg aaacggagaa gtatccgata aatatccaga agctatttgc agtaaaacca        60
     ccccttgtgt ataagacgcc gctagattac cccgctgaat caagatgcac caatcatata       120
     acatccgtaa gttcatttag aaatcaatgg cagcaatatg tggatgatct agttgaagca       180
     gagaaaaacc aaccgccacc gatagagaca attcaacagg tacaaataag ggaaaagggg       240
     cgtaagaaac aggaattaca aaaatcatat caactacaat tgaacgagtg gaacgaccct       300
     gagttgttac agaaaaatga acaggaattc atgaaggatc cattcaagac ggtttttatt       360
     tccagattgg actatttgtt gacagagttg gacatatcaa agaactttag taagtatggt       420
     gtcattgaat ccataactat tgtaagagac aagaaactgg gtaaatcacg gggctatggg       480
     tttgtagttt ttgaacgaga cgaggacgcc aaaggttgca ttaaggaatt agcccccacc       540
     gggttgaaaa tccccgtcga aaataaacct ttcactagaa ctatactcgt ggatatggaa       600
     agaggtagac tagtaagaaa ctggaaacct agaaggttag gtggaggatt agggggaaga       660
     cattatacga gaccaagtcc tactctctcc aataatgcct cagcagcagc atcaggtaga       720
     agattgcatc tatcaagcaa tccataccaa agcaccccgc tgcaaccatc acacctgtct       780
     acaaggtatg ctcctaggcc tagcgcccct cgacctatgg ttgagaatag acagccacgt       840
     ccagccgcgt atggttctta caatagtctg gttgaaaaca acgaatcggt tcgtgacaaa       900
     tatgctaagt attcgagcaa caacgattca aactcctcta gttatcgctc gcctagaaca       960
     tcgggccaaa ataggtccat tagaagcatt cgacaacgag aatga                      1005
//

If you have problems or comments...

PBIL Back to PBIL home page