(data stored in ACNUC6288 zone)

EMBL: CR382138.PE339

CR382138.PE339       Location/Qualifiers
FT   CDS_pept        682885..684258
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F07876g"
FT                   /old_locus_tag="DEHA0F08767g"
FT                   /old_locus_tag="DEHA-IPF8443"
FT                   /old_locus_tag="DEHA-CDS2670.1"
FT                   /product="DEHA2F07876p"
FT                   /note="weakly similar to uniprot|P40517 Saccharomyces
FT                   cerevisiae YIL063C YRB2 Ran-GTPase-binding protein involved
FT                   in nuclear export"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F07876g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89042"
FT                   /db_xref="GOA:Q6BM69"
FT                   /db_xref="InterPro:IPR000156"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BM69"
FT                   /protein_id="CAG89042.1"
FT                   /translation="MSNDTSNKRKLEEEDLSDNKKVRQESPDSVVDDLNYLKESIKQEI
FT                   FKTFEDRFNRLENEIIQLKSTSKDDSGTLSERTANEGSVDTPPDEASLKVSSGVPKLHP
FT                   LNPTVGELPKSNSNPFNEIKGFKSMESNEKSTDPKPSKHTFGGSSFKINTPMNSFVSNA
FT                   NPADTPTAPNTAQSSPQHVFGATSSFGSASAFDVAKSKKNVFEALPSKTTNEISKSPSA
FT                   EISKSNSSSVTSSFGSGTFGGNTKFNNAFQNSLKKKSFLDDKANKDGKTEETADTGNTA
FT                   KEKTPTTQQYKQVDLTPVGEIRTGEENEKSHFTSTAKIFELNLTKISDGWKERGLGRLH
FT                   LNQSLDDPQKVRLVMRSQGLLRVVLNMKVTSDTKLIKGLEASLSPGKFVRWNSINDQGA
FT                   PVQYLLKFPNQTIRDELIEKVENLKETFETESMSKGTESSSGVESKETKPNATGVKWL"
     atgtcaaatg atacctctaa caagagaaag ttagaggaag aagatctcag cgacaacaaa        60
     aaagtgagac aggaaagtcc cgattctgta gttgacgatt tgaattattt gaaagagagc       120
     atcaagcaag aaatattcaa gacgtttgaa gacaggttta ataggttaga gaatgaaatc       180
     atacaattga aatctacttc taaagatgat tctggtactt tatctgaaag gactgcgaac       240
     gagggatctg tcgatacgcc tcctgatgaa gccagtctta aagtttcctc aggtgtacct       300
     aaattgcatc ctttgaatcc tacagttggt gaattgccca aatcgaattc aaatccattt       360
     aatgaaatta agggtttcaa atcgatggag agtaatgaaa aatctaccga ccccaaacca       420
     tctaaacata cttttggggg aagctcattc aaaatcaata cgcccatgaa ttcatttgtg       480
     tcgaatgcca atccagccga tactcctact gctccaaata ctgctcaatc atctcctcaa       540
     catgtttttg gtgccacaag ttcatttgga agcgcttctg cttttgacgt cgcaaaaagc       600
     aagaagaatg ttttcgaagc tttaccatca aagactacaa acgagatttc aaaatctcct       660
     agtgctgaaa tttccaagag caattcgtca tcagtgacat cttcttttgg ctctggtaca       720
     tttggaggca acacaaaatt taacaacgca tttcagaatt ctttgaagaa gaaatcattt       780
     ttagatgata aagcaaataa ggatggtaaa actgaagaaa cagctgacac gggaaacacc       840
     gccaaagaaa agactccgac tacacaacaa tataagcagg ttgatttgac tccagttgga       900
     gaaatcagaa ctggagaaga gaatgaaaaa tcccatttca catccacagc taaaatattc       960
     gaattaaatt taactaaaat ttccgacgga tggaaagaaa gaggtttagg taggttgcat      1020
     ttgaatcaat cccttgatga cccacaaaaa gtgagattgg tcatgagatc tcaaggattg      1080
     ctcagagttg tcttgaacat gaaagtgact tccgatacta agttgatcaa aggtttagaa      1140
     gcaagcttat ctccaggaaa atttgttaga tggaattcta ttaatgatca aggagcgccc      1200
     gtgcaatatt tgcttaaatt tcctaaccaa accattagag acgagttgat tgaaaaagtt      1260
     gagaatttga aagagacttt tgaaacagaa tcaatgtcaa agggtactga atctagttcc      1320
     ggtgtagaat cgaaggaaac aaaaccaaat gctacaggtg tgaaatggtt atag            1374
//

If you have problems or comments...

PBIL Back to PBIL home page