(data stored in ACNUC6288 zone)

EMBL: CR382138.PE341

CR382138.PE341       Location/Qualifiers
FT   CDS_pept        685319..686737
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F07920g"
FT                   /old_locus_tag="DEHA0F08811g"
FT                   /old_locus_tag="DEHA-IPF8439"
FT                   /old_locus_tag="DEHA-CDS2547.1"
FT                   /product="DEHA2F07920p"
FT                   /note="weakly similar to uniprot|P13712 Saccharomyces
FT                   cerevisiae YBR195C MSI1 Subunit of chromatin assembly
FT                   factor I (CAF-I) regulates the RAS/cAMP pathway via
FT                   sequestration of Npr1p kinase"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F07920g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89044"
FT                   /db_xref="GOA:Q6BM67"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR022052"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BM67"
FT                   /protein_id="CAG89044.2"
FT                   /translation="MNGEELVLNDTVENSDVSNVDMQSDKPDDVTVVEHSPIDQQTEVN
FT                   YRIWKKNAPFLYDYITTHSLLWPSLTVQFFPDLEKPLSKDAMLDPFQDFKKADSNGSKS
FT                   ENEASMQRILLGTFTLGQSTDSISILQLPYYTNLNKNLTIDKLDYNHEKEEFELTKIAK
FT                   KKINVLQKINHWGDVNKSRYMPQNPDVIASSNNLGNLVIYDRTKHASFKNSLIGEDTEI
FT                   NKPQLHLINEWNPSDADIFAIDWNKQKEGVIISANMEGNINLYDIKSKFTSKDVQTINE
FT                   SQHFGNSNIAINDIEWIPNHDSILTYVDDQGSIKLLDVRLPEHQSLVLQHQKSNKGINS
FT                   VSVNPGNQACLATGDIDGMIDVWDIRSFGSGNANSVYNIKKQHEGSITQLKWHPKYHNI
FT                   LASSSSDKSVKIFDLNTIEEEEGLIFTHAGHMLGVNDLDWSLHDDWMMASVADDNSLHV
FT                   WKPSSQIVKQYKSI"
     atgaacggtg aagaacttgt ccttaacgac acagtggaga attctgacgt ttcaaatgtt        60
     gatatgcaat ctgataaacc cgacgatgta acagtagttg aacattcgcc aattgatcaa       120
     caaacagaag tcaactacag aatttggaaa aagaatgccc catttctcta tgactatata       180
     acaacccatt ccttgttatg gccaagtttg acagtacaat tttttccaga tttagagaag       240
     cctttatcta aggacgctat gttggatcca ttccaagact tcaaaaaggc tgattcaaat       300
     ggttctaaat cagagaatga agcgtccatg caaagaattt tacttggtac atttactctt       360
     ggccaatcga cagacagtat ttcaattctt cagttgccat attatactaa tttaaataaa       420
     aatctcacca tagataaact agactataat cacgaaaaag aagaatttga attaacaaag       480
     atagcaaaga agaaaatcaa tgttctacag aagataaatc attggggtga cgttaataaa       540
     ctgagatata tgccccaaaa ccctgacgtc attgcaagtt ctaataattt gggtaaccta       600
     gtgatttatg acagaaccaa gcatgctagt tttaagaata gtttgatagg cgaagatacg       660
     gaaataaaca agcctcagtt gcatttaatt aatgaatgga acccgtctga tgctgatata       720
     tttgccattg attggaacaa acaaaaagaa ggcgtgataa tatcagcgaa tatggaaggt       780
     aatattaact tatacgatat taaaagtaaa tttacctcca aggatgtgca gaccataaat       840
     gaatcacaac attttggtaa ttcaaatatt gctataaacg atatagaatg gataccgaac       900
     catgactcca ttctcaccta cgttgatgat cagggaagta ttaaattact tgatgtaaga       960
     ttaccagaac atcaactgtt agttcttcag caccaaaaat caaacaaagg aattaacagt      1020
     gtgagtgtta atccagggaa ccaagcatgt ttagctacag gagatattga tggtatgata      1080
     gatgtttggg atattagatc gtttggttca ggtaatgcaa acagtgtata taatattaaa      1140
     aaacaacatg aaggatccat tacacaattg aaatggcatc caaaatatca taatatttta      1200
     gcatcttcat ctagtgataa gctggttaag atatttgatt taaatacaat tgaagaggag      1260
     gaagggctca tttttactca tgctggacat atgttaggcg taaatgattt agattggtct      1320
     ttgcatgacg attggatgat ggcaagtgtt gcagatgata attctttaca tgtttggaaa      1380
     ccttcgagtc aaatagtcaa gcaatacaaa tccatatag                             1419
//

If you have problems or comments...

PBIL Back to PBIL home page