(data stored in ACNUC6288 zone)

EMBL: CR382138.PE346

CR382138.PE346       Location/Qualifiers
FT   CDS_pept        694025..694885
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F08030g"
FT                   /old_locus_tag="IPF_8433"
FT                   /product="DEHA2F08030p"
FT                   /note="similar to uniprot|P36144 Saccharomyces cerevisiae
FT                   YKR060W UTP30 Possible U3 snoRNP protein involved in
FT                   maturation of pre-18S rRNA based on computational analysis
FT                   of large-scale protein-protein interaction data"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F08030g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89049"
FT                   /db_xref="GOA:Q6BM62"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BM62"
FT                   /protein_id="CAG89049.1"
FT                   /translation="MVSSFILGQSALADGTKSAKSLASHIGKENGPTHHEAVYLIINTK
FT                   IYLTKIKDYTPRIIPLSKGLDKLENKSVLLVTKDPSLPYRDALTKKDSPTEDVFNQIYT
FT                   LTKLKHISKDPKKLTKLFKEFDIIVADNRVHKFLPDILGARFYVKNKKIPFMVQMAKPD
FT                   KDARLSKGKKSTKLKDDRCEPEYVRYQMKSIVRNASYIPSATGTCISVKIGYSDWKPEE
FT                   LLTNANDVIKYLVEPKFLPVGGLLRTPKNLVSVHIKTSESISLPIFKQKEDIKEEDDDD
FT                   SDLDF"
     atggtatctt cgttcatctt aggtcagtcc gcattggcgg atggtacgaa atcggccaag        60
     tcattagcca gtcatatcgg aaaagaaaat ggaccaaccc atcacgaagc cgtatattta       120
     ataattaata ccaaaatata tctcactaaa ataaaagact atactcccag aattattccg       180
     ttaagtaagg gattggataa attagaaaat aaatcagtat tgttagtaac caaagatcca       240
     tctttgccct atcgtgatgc attaacgaaa aaagattcgc ctacagaaga tgttttcaac       300
     caaatatata ccttaactaa attgaagcac atatctaaag atcccaaaaa attgacgaaa       360
     cttttcaaag aatttgacat tattgttgcg gataatagag tacacaagtt cttgccagat       420
     atcttaggag ctcgatttta cgttaaaaat aagaaaatac ctttcatggt ccaaatggcc       480
     aagcctgaca aagatgccag attgtcgaag ggaaagaagt ctacaaagct aaaggatgac       540
     agatgtgagc cggagtacgt tagatatcaa atgaaatcta tagtgagaaa tgcctcatat       600
     attccatcag ctacaggaac atgcatctct gttaagatag gttatagtga ctggaaacca       660
     gaggaattat tgaccaatgc taacgatgta ataaagtatt tggtcgagcc aaaatttctt       720
     cctgttggag gattgttaag aactcccaaa aacttagtta gcgttcatat taagactagt       780
     gaaagtataa gtttacctat tttcaagcag aaagaagaca taaaggaaga agatgatgac       840
     gatagtgact tggattttta g                                                 861
//

If you have problems or comments...

PBIL Back to PBIL home page