(data stored in ACNUC6288 zone)

EMBL: CR382138.PE350

CR382138.PE350       Location/Qualifiers
FT   CDS_pept        complement(701221..702315)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F08118g"
FT                   /old_locus_tag="IPF_8425"
FT                   /product="DEHA2F08118p"
FT                   /note="similar to uniprot|Q7S4H9 Neurospora crassa NCU08171
FT                   Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F08118g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66299"
FT                   /db_xref="UniProtKB/TrEMBL:B5RUC1"
FT                   /protein_id="CAR66299.1"
FT                   /translation="MRLLSFVIILSWISWVVAESCTGEQKLNLEDFQFVEHSNENLDGL
FT                   SEKLKSREVSLTKVIEDGNHKLTKASPWEYSAVKDAIQWESKDGFDDLNTKKWVPQGIS
FT                   SSADAYDKGDWNGKEAWIVSWHNEDDTSVRVTFVDKETNKYRHVLLVYPTAKDDFGPVQ
FT                   IHAGGIAWYGDKLYVVDTDIGLRMFDLSTIWEVDDGSKIGKDGTKYTAASYKYVIPQIS
FT                   YYKLTPQRDFKFSYVALDRTSTPYSLIVGEYRTASSGKKTRLVKWNLDSENRKLKSKTA
FT                   SFGYCIGQPRMQGAVSVGEKVYISVSNEKNPGDLYTWTAGSKPKRESSFFPPSPEDLAY
FT                   NKHGNELYGLTEGIGKRYILTYGL"
     atgagattat tatcatttgt aattattttg agctggatat cgtgggtggt tgcagaaagt        60
     tgcacgggag aacagaaact taatctagaa gattttcagt ttgttgagca ttccaatgaa       120
     aacttagatg gtctatcaga aaaattgaaa agtcgtgaag tatctttgac aaaagtcatt       180
     gaagatggta atcataaatt aacaaaggcg agtccatggg agtattcggc tgtgaaagat       240
     gctatccaat gggaaagtaa ggatggattc gatgatttaa acactaaaaa atgggttcct       300
     caaggtattt catcctcggc ggatgcatat gataagggtg attggaatgg aaaagaggca       360
     tggattgtta gctggcataa cgaagatgat actagtgttc gtgttacatt cgttgacaag       420
     gaaactaaca agtatagaca cgttttacta gtttatccaa cagctaaaga tgattttggg       480
     cctgttcaga ttcatgcggg cggaatagca tggtatggag acaagctata tgttgtggat       540
     acagatatcg gtctaagaat gtttgattta tctacaatat gggaggtgga tgatggtagt       600
     aaaattggaa aggatgggac taagtataca gctgctagtt ataagtatgt tattccccaa       660
     attagctact ataaattaac ccctcaacgg gatttcaaat tttcatatgt cgctcttgat       720
     cgaacctcta ccccgtattc tttaatagtg ggggagtatc ggacagctag ttctgggaaa       780
     aaaaccagat tagtcaaatg gaacttggat tctgaaaaca ggaaactaaa gtcaaagact       840
     gccagttttg gctattgtat tggacagcct cgaatgcagg gtgcagtttc cgtcggtgaa       900
     aaggtttaca tttcagttag caatgaaaag aatcctggtg atttatacac ctggacagct       960
     ggctctaagc caaagagaga gtcaagcttc tttccaccaa gtccggaaga tcttgcctat      1020
     aacaaacacg gcaatgaact ttacggtcta acagaaggta ttgggaaaag atatattctt      1080
     acttatggtt tatag                                                       1095
//

If you have problems or comments...

PBIL Back to PBIL home page