(data stored in ACNUC6288 zone)

EMBL: CR382138.PE351

CR382138.PE351       Location/Qualifiers
FT   CDS_pept        703726..704301
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F08140g"
FT                   /old_locus_tag="DEHA0F09031g"
FT                   /old_locus_tag="DEHA-IPF8423"
FT                   /old_locus_tag="DEHA-CDS5455.1"
FT                   /product="DEHA2F08140p"
FT                   /note="similar to uniprot|P20433 Saccharomyces cerevisiae
FT                   YJL140W RPB4 RNA polymerase II subunit B32"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F08140g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89054"
FT                   /db_xref="GOA:Q6BM57"
FT                   /db_xref="InterPro:IPR005574"
FT                   /db_xref="InterPro:IPR006590"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR038324"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BM57"
FT                   /protein_id="CAG89054.2"
FT                   /translation="MNVSTSALGVRRRKPTTQNIDDEENAATLSLGPEFQLTQLTNSGE
FT                   EEQLIALNLSEARLLIRAALKERKNKNQANSEFDDEDEDNVKEDEISNMDLAGPNSNEI
FT                   MHKTLNYLSNFSRFKNSSSTETVEKLLNDFNFSTSEPLHPFELAQLGTLECEDAEEAKS
FT                   LIPSLTNKVSDVQLQTLLTELRKYQTLS"
     atgaatgtta gtacaagtgc attaggtgtt agaagaagaa agccaaccac acaaaatata        60
     gacgatgaag agaacgccgc cacattactg ttgggtcctg agttccaact tacacagtta       120
     acaaattcag gagaagaaga gcagttaatc gcgttaaact tatcagaggc tagattgttg       180
     attagggcag ctttaaagga acgtaagaat aaaaaccaag cgaacagcga atttgatgat       240
     gaagacgaag ataatgtaaa ggaagatgaa atttcaaata tggatttagc agggccaaat       300
     tcaaacgaaa taatgcataa gacattaaac tacttatcca atttttctag atttaaaaac       360
     tcctcatcca cagaaaccgt tgaaaaatta ctaaacgact ttaatttttc tacatcagaa       420
     ccgttacatc ctttcgaatt agcccagctc ggtaccttag aatgtgaaga tgcagaagaa       480
     gcaaaatcgt tgattccaag tttgactaat aaagtttccg atgttcaatt gcaaactctt       540
     ttaacagaat taaggaagta tcaaacatta tcctga                                 576
//

If you have problems or comments...

PBIL Back to PBIL home page