(data stored in ACNUC6288 zone)

EMBL: CR382138.PE356

CR382138.PE356       Location/Qualifiers
FT   CDS_pept        714722..715006
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F08250g"
FT                   /old_locus_tag="DEHA0F09141g"
FT                   /old_locus_tag="DEHA-IPF8410"
FT                   /old_locus_tag="DEHA-CDS7468.1"
FT                   /product="DEHA2F08250p"
FT                   /note="similar to uniprot|P08525 Saccharomyces cerevisiae
FT                   YJL166W QCR8 Ubiquinol cytochrome-c reductase subunit 8 (11
FT                   kDa protein)"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F08250g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89059"
FT                   /db_xref="GOA:Q6BM52"
FT                   /db_xref="InterPro:IPR004205"
FT                   /db_xref="InterPro:IPR036642"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BM52"
FT                   /protein_id="CAG89059.1"
FT                   /translation="MAGAGPKAYMGWWGNIGSPKQKYVTTYTVSPYATKPLKGALYNSV
FT                   FNVFRRVKNQTLFVVIPAVIVWNVWAQARDYNEYLYTKAGREDLEKANA"
     atggctggtg caggtccaaa agcttacatg ggatggtggg gtaacatcgg ttccccaaag        60
     caaaaatacg ttactactta taccgtttct ccatacgcta ctaaaccttt gaagggtgct       120
     ttatacaact ctgttttcaa cgtttttaga agagttaaga accaaacctt attcgttgtt       180
     atcccagctg ttattgtctg gaacgtctgg gctcaggcca gagattacaa cgaatacttg       240
     tacactaagg caggcagaga agatttagaa aaggctaacg cttaa                       285
//

If you have problems or comments...

PBIL Back to PBIL home page