(data stored in ACNUC6288 zone)

EMBL: CR382138.PE365

CR382138.PE365       Location/Qualifiers
FT   CDS_pept        complement(726651..727748)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F08448g"
FT                   /old_locus_tag="IPF_8396"
FT                   /product="DEHA2F08448p"
FT                   /note="similar to uniprot|P38127 Saccharomyces cerevisiae
FT                   YBR192W RIM2 Protein of the mitochondrial carrier (MCF)
FT                   family that is required for respiration"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F08448g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66303"
FT                   /db_xref="GOA:B5RUC5"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/TrEMBL:B5RUC5"
FT                   /protein_id="CAR66303.1"
FT                   /translation="MGSSRNEKLHNLEEDAKSSFPYLASDEKSSTIRNPEKLEYTKGTI
FT                   EPKSQTKPWVHFVAGGIGGMVGAVATCPLDVVKTRLQSDVYHSTYNKTPKSSNPVIKAA
FT                   QHFKETGTVIRGLYANEGTRALFKGLGPNLVGVIPARSINFFTYGATKDFISSNFNNGQ
FT                   EETWIHLVSGINAGFVTSTATNPIWLIKTRLQLDKTKGKHYKNSWDCFKNVIKHEGVKG
FT                   LYKGLSASYLGGVESTLQWVLYEEMKSIINKRSIEAHGLRAENKTTKDYILEWSARSGA
FT                   AGAAKFIASLITYPHEVVRTRLRQAPLESTGKPKYTGLIQCFKLVIKEEGLASIYGGLT
FT                   PHLLRTVPNSIIMFGTWEIVVRLLS"
     atgggaagtt ccagaaatga aaagttacat aatttagagg aagatgcaaa atcatcattt        60
     ccatatcttg cttccgatga gaagtcttct actataagaa accccgaaaa actcgaatat       120
     actaaaggca caatagaacc taaatcacag actaagccat gggttcattt tgtggcgggt       180
     ggaataggtg gtatggtcgg agcggtagct acttgtccat tagacgttgt taaaacaagg       240
     ttacaatctg acgtctatca ttccacatat aataaaactc cgaaatcttc gaatccagtc       300
     atcaaagcag cacaacattt caaagaaact ggcactgtta ttagaggttt gtatgccaat       360
     gaaggtacta gagcattatt caaagggttg ggaccaaatt tggttggcgt aattcctgcg       420
     agatctataa atttcttcac atacggtgcc accaaggatt tcatttcttc taacttcaac       480
     aacggtcaag aagagacttg gatccatttg gtgtctggta tcaatgcagg gtttgtaact       540
     tctaccgcca cgaaccccat ttggttaatt aaaacaagat tgcagttaga caagactaaa       600
     gggaagcact ataaaaattc atgggattgc ttcaagaatg tgataaaaca tgagggtgtt       660
     aaaggccttt ataaaggttt aagtgcatcc tacttaggtg gtgttgaatc tacattacaa       720
     tgggttctct atgaagagat gaaatctatt atcaataaac gttctattga ggcgcatgga       780
     ttaagagctg agaataaaac tacaaaagat tatattttag aatggtctgc aagatcaggt       840
     gcagccggtg ctgcaaagtt tattgcatca ttaataacat atccacatga ggttgttaga       900
     actcgtttga gacaagctcc attagaatct actggtaaac cgaaatatac tggcctaata       960
     caatgtttca agttagttat taaggaagaa ggtcttgcaa gtatatatgg tggtttgaca      1020
     cctcatttat tgagaaccgt tcctaattct ataattatgt ttggtacttg ggaaattgtc      1080
     gtgagattgt tatcctag                                                    1098
//

If you have problems or comments...

PBIL Back to PBIL home page