(data stored in ACNUC6288 zone)

EMBL: CR382138.PE377

CR382138.PE377       Location/Qualifiers
FT   CDS_pept        complement(751782..752987)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F08712g"
FT                   /old_locus_tag="DEHA0F09603g"
FT                   /old_locus_tag="DEHA-IPF8377"
FT                   /old_locus_tag="DEHA-CDS3172.1"
FT                   /product="DEHA2F08712p"
FT                   /note="similar to uniprot|P41338 Saccharomyces cerevisiae
FT                   YPL028W ERG10 Acetyl-CoA C-acetyltransferase (acetoacetyl-
FT                   CoA thiolase) cytosolic enzyme that transfers an acetyl
FT                   group from one acetyl-CoA molecule to another forming
FT                   acetoacetyl-CoA"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F08712g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89081"
FT                   /db_xref="GOA:Q6BM30"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BM30"
FT                   /protein_id="CAG89081.1"
FT                   /translation="MSSVYIVSTARTPIGAFQGGLSSLTYSDLGSHAVHAALKKVPQIK
FT                   AEDVEEIIFGGVLQANVGQAPARQVALKAGLPESIVATTVNKVCASGMKSIILGAQTIL
FT                   TGTADIVVAGGAESMSNTPYYVPSARGGARYGDAVMVDGVQKDGLLDVYENKLMGVAAE
FT                   KCAKDHSFTRDDQDNFAIGSYTKAADAQNAGKFDNEIAPVTIPGKRGKPDVVVANDEEI
FT                   KNFDEPRLRSARAVFQKENGTVTAPNASSLNDGGAAVILVSEKKLKELNLKPLAKISGW
FT                   GEAARAPIDFTIAPSLAIPKALKHANLSMDDIDFFELNEAFSVVGLANAKICNIPSKKL
FT                   NVYGGAVALGHPLGCSGARIVVTLLSVLAQEGGKIGVAGVCNGGGGASSIIIERFDHDS
FT                   KL"
     atgtcttcag tctatatcgt ttctactgct cgtactccaa tcggtgcatt tcaaggggga        60
     ttatcatcgt taacatattc agatttagga tcacatgctg ttcatgccgc tttgaagaag       120
     gttccacaaa ttaaggcaga agatgttgaa gaaatcatat ttggtggtgt cttacaagct       180
     aacgttggtc aagctccagc taggcaagtt gctttaaaag ctgggttacc agaatcgatt       240
     gtggccacca cggttaataa ggtttgtgcc tcgggtatga agtcgattat tttgggagcg       300
     caaactattt tgaccggtac tgcggatatc gttgtcgctg gtggtgctga atctatgtcg       360
     aacacaccat actacgtgcc atctgctaga ggtggtgcca gatacggtga cgcggttatg       420
     gttgatgggg ttcaaaagga cgggttgttg gatgtgtatg aaaacaagtt gatgggtgtt       480
     gctgctgaaa aatgtgccaa ggaccatagc ttcaccagag acgaccaaga caacttcgct       540
     atcggttcat acaccaaggc tgcggacgca caaaatgccg gtaagttcga taacgaaatc       600
     gcacctgtta ccatcccagg taagagaggc aagccagatg tggttgtcgc taacgacgaa       660
     gaaattaaga acttcgacga acctagattg agatctgcta gagctgtctt ccaaaaggaa       720
     aatggtaccg ttactgctcc aaatgcatct tcgttgaacg acggtggtgc tgctgttatc       780
     ttggtctctg aaaagaaatt gaaggaattg aacttgaagc ctttggctaa aatttctggt       840
     tggggtgaag ccgccagagc tccaattgat ttcacaattg ctccatcctt ggcaattcca       900
     aaggctttga aacacgccaa cctctccatg gacgatattg acttctttga attaaacgaa       960
     gccttttcag tcgttggttt agctaacgct aagatctgta acattccatc taagaaattg      1020
     aatgtttacg gtggtgctgt cgccttaggt cacccattag gttgttctgg tgccagaatt      1080
     gttgtcacct tattatcagt cttggctcaa gaaggtggta aaattggtgt cgccggtgtc      1140
     tgtaatggtg gtggtggtgc atcttctatc attattgaaa gatttgacca tgactccaaa      1200
     ttataa                                                                 1206
//

If you have problems or comments...

PBIL Back to PBIL home page