(data stored in ACNUC6288 zone)

EMBL: CR382138.PE379

CR382138.PE379       Location/Qualifiers
FT   CDS_pept        complement(754259..755488)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F08756g"
FT                   /old_locus_tag="DEHA0F09647g"
FT                   /old_locus_tag="DEHA-IPF8371"
FT                   /old_locus_tag="DEHA-CDS3197.1"
FT                   /product="DEHA2F08756p"
FT                   /note="weakly similar to uniprot|P38615 Saccharomyces
FT                   cerevisiae YMR139W RIM11 Protein kinase required for signal
FT                   transduction during entry into meiosis"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F08756g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89083"
FT                   /db_xref="GOA:Q6BM28"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR039192"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BM28"
FT                   /protein_id="CAG89083.2"
FT                   /translation="MSKIEVITENVNNGHTGELQTIQYTQSQMVGHGSFGVVFETQILP
FT                   SNEIAAIKRVLQDKRFKNRELQIMKLVHHRNIVDLKYYFYTNNDKSELYLNLILEFVPE
FT                   TLYKASHYYVSKRLSMPSLEVKLYTYQMLRALNYIHSQGICHRDIKPQNLLINPETGEL
FT                   KLCDFGSAKILNPAEPNVSYICSRYYRAPELIFGATNYTTKIDVWSAGCVMAELILGQP
FT                   LFPGESGIDQLVEIIKILGTPSKDQIKNMNPNYMEHKFPQIKPIPLQKIFKKMSNDCIQ
FT                   FLIKVLQYSPHERISCITALADPYFNELRNQTTKLPNYRKLFSKQYHQNSTGGNLNHHN
FT                   NANYQLFNNQPDIRDLPQLFDFDDRELSVDPSLNHILIPEFALDSLKLSSGDLQSFRPL
FT                   TSEELKVTLD"
     atgtcaaaaa tagaggtcat aaccgaaaat gtgaataacg gacacaccgg tgagttacag        60
     acgatccagt atacccaatc gcagatggtg ggccatgggt catttggagt tgtgttcgag       120
     acgcagatct tgccatctaa cgagatagcg gctatcaagc gggtgttgca agacaagcgg       180
     tttaagaaca gagagttgca gatcatgaag ttggtacatc accgcaatat tgtggacttg       240
     aagtactatt tttacacgaa caacgacaag agtgagttgt accttaactt gattttggag       300
     tttgtgccag aaacattgta caaggcgagc cattattatg tgtcgaagcg gttgtcgatg       360
     ccgctgttag aagtgaagtt gtacacatac cagatgttgc gggcgttgaa ttacatccat       420
     tctcagggaa tctgtcatcg ggacatcaag cctcagaact tgttgattaa ccccgagacg       480
     ggtgagttga aattgtgcga ctttggctcg gccaagatct tgaatccagc agaacctaac       540
     gtgtcgtata tttgctcgag atactacagg gctcccgaat tgatctttgg tgcaaccaac       600
     tacaccacca agatcgatgt gtggtcggca ggatgtgtca tggctgaatt gatcttgggc       660
     cagccattgt tccccggcga gctgggtatt gaccagttag tcgagattat caagatcttg       720
     ggtacgccgt cgaaagacca gatcaagaac atgaacccca actacatgga gcacaagttt       780
     cctcagatta agcctatccc attacaaaaa attttcaaga aaatgtcgaa cgattgcatc       840
     caatttttaa ttaaggtgtt acaatattcg cctcacgaaa gaatctcgtg catcactgca       900
     ttggccgatc catattttaa cgagttaaga aatcagacta caaaactacc aaattataga       960
     aaattatttt ccaagcaata tcatcaaaat tccaccggtg gaaacttaaa ccatcacaat      1020
     aacgccaatt atcagttgtt caacaatcag cctgatatca gggacttacc gcaattgttc      1080
     gatttcgacg atcgtgaatt gtcggtcgac ccgctgttga accacatctt gattcctgaa      1140
     tttgccttgg atagcttgaa attgtcgagt ggtgatttac aatccttcag acctttgaca      1200
     agtgaagaat taaaagtcac tttggattag                                       1230
//

If you have problems or comments...

PBIL Back to PBIL home page