(data stored in ACNUC6288 zone)

EMBL: CR382138.PE382

CR382138.PE382       Location/Qualifiers
FT   CDS_pept        complement(757376..758347)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F08822g"
FT                   /old_locus_tag="IPF_8364"
FT                   /product="DEHA2F08822p"
FT                   /note="weakly similar to uniprot|P43568 Saccharomyces
FT                   cerevisiae YFL029C CAK1 Cyclin-dependent kinase-activating
FT                   kinase required for passage through the cell cycle
FT                   phosphorylates and activates Cdc28p"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F08822g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66306"
FT                   /db_xref="GOA:B5RUC8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:B5RUC8"
FT                   /protein_id="CAR66306.1"
FT                   /translation="MNQYGTKETIYSGPNAIVYKAIDRESQNIVALKVVDVDLCMKPHD
FT                   IRREITTLQRIHNKGVLQFINSYTHGDDIVLVTPCYSFDLDQWIKMCTKKRVKFNLDDP
FT                   TNNIIHYRNEFPTSKVENIISTLASTLRYLHDDEGIIHRDIKPSNVYFESEDSPPVLGD
FT                   FGIIYNTRDPPSDEPMDSKYTDVSTGIFKAPELCFGMADYTQAIDIWSLGIMLTLLYSA
FT                   TGKSCIDEEGNFHDLTLISSIFSNFGTPSTSDASDKRLYWPDANRPSSHFNSFKFTEKP
FT                   RVPSDKLLPRCDNPNMLRIFDRMMVYQGNERITAKEILTCIE"
     atgaaccaat acggtaccaa ggagacaata tatagcggac ctaatgcaat cgtgtataaa        60
     gcaattgacc gtgaaagcca aaatatagtg gcattgaagg tagtggatgt tgatttatgt       120
     atgaaacccc acgacataag gcgggagatc accacattac aaagaataca taataaagga       180
     gtactacaat tcataaacct gtatacacat ggcgatgata tagtattggt aacaccatgt       240
     tatctgttcg atctagatca atggatcaaa atgtgtacca agaagcgggt caagttcaac       300
     ctcgatgatc ctaccaataa tattatccac tatcgcaacg aatttccaac aagcaaagta       360
     gagaacatca tttccacatt agccagtacc cttaggtacc tccatgatga tgaaggtata       420
     atacaccgcg atattaagcc atcaaacgtg tatttcgagt ccgaagactc gcctccggtt       480
     cttggggatt tcgggattat atacaatacg agagaccccc cctctgatga acctatggac       540
     tccaagtaca cagatgtatc caccggcata ttcaaggcgc ctgaattgtg ttttggcatg       600
     gcggactaca cgcaagccat cgatatctgg tcgttgggta ttatgctcac attgttgtat       660
     tcagcaaccg gaaaatcgtg tatagatgag gaaggaaact tccacgactt gacgcttatc       720
     agttccatat ttctgaactt tggtactccc ctgacgagtg atgcttctga taagcgactc       780
     tattggcccg atgctaatcg accactgagc cattttaaca gtttcaaatt cacagaaaag       840
     ccccgggtac caagtgataa gctattaccg cgatgtgata accctaacat gctacgtatc       900
     tttgacagga tgatggttta tcagggtaat gaaagaatta ctgctaaaga aatcctcacg       960
     tgtatagaat ga                                                           972
//

If you have problems or comments...

PBIL Back to PBIL home page