(data stored in ACNUC6288 zone)

EMBL: CR382138.PE383

CR382138.PE383       Location/Qualifiers
FT   CDS_pept        complement(758720..760138)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F08844g"
FT                   /old_locus_tag="DEHA0F09735g"
FT                   /old_locus_tag="DEHA-IPF8362"
FT                   /old_locus_tag="DEHA-CDS2546.1"
FT                   /product="DEHA2F08844p"
FT                   /note="similar to uniprot|P39073 Saccharomyces cerevisiae
FT                   YPL042C SSN3 Component of RNA polymerase II holoenzyme
FT                   involved in RNA pol II carboxy-terminal domain
FT                   phosphorylation"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F08844g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89087"
FT                   /db_xref="GOA:Q6BM25"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BM25"
FT                   /protein_id="CAG89087.2"
FT                   /translation="MNSGYNPGNANHITSHSNRTKNGVPTIPQPALMASNAILTIGPYK
FT                   HRKDLIRESVLTKYQIIGYIAAGTYGKVYKAKSKTNGNSNSNSALMNDNVISIGNGQKE
FT                   AGLQKTNNESMEDKNQLFAIKKFKSDNHSNKNNHDINGNEVIHYTGISQSAIREMSLCR
FT                   ELSNKNITKVVDILLENKSIYMVFEYCEHDLLQIIQYHSHPDVKPIPDFTIKSITWQIL
FT                   NGVTFLHKNWIFHRDLKPANIMVSSSGVVKIGDLGLARKFNNPLQSLYTGDKVVVTIWY
FT                   RAPELLLGARHYTPSIDLWAVGCILAELLSLRPIFKGEEAKIDMNNKKSVPFQKNQLQK
FT                   IVEVLGTPTTKNWPTITKYPEYSAFQQHFSNTYPPNLISWYKLIGRTSKQCLNLLRCLL
FT                   EYDPTIRITADDALTHAFFLELPKMSENSFEGLSQKYPKRRIYTHENDIVSNSQHVNNK
FT                   RHGYDDNMTRKRQR"
     atgaattccg gttataatcc tggaaatgca aatcatataa catcacattc gaatagaaca        60
     aaaaatggcg ttccaacgat tccccagcca gccttgatgg cactgaatgc catattaact       120
     atcggaccgt ataaacatag gaaagattta ataagagaat ctgttctaac caagtaccaa       180
     ataattggtt atattgcagc aggaacgtat ggaaaagtct acaaagctaa atctaaaacg       240
     aatggaaacc tgaattccaa ctctgcatta atgaatgata atgtgataag cataggaaac       300
     ggtcaaaagg aagcaggcct ccaaaaaaca aacaatgaac tgatggaaga taaaaatcaa       360
     ctatttgcta taaagaagtt caaaagcgat aaccatctga ataagaataa tcatgatatc       420
     aacgggaatg aggttattca ttatactggt atatcgcaat cagctatcag agaaatgtct       480
     ctatgtcggg agctaagtaa taagaatata actaaagttg ttgatatatt gctagagaat       540
     aaatccattt atatggtatt tgaatattgt gaacatgatt tattgcaaat tattcagtat       600
     cattcgcatc cagacgttaa accaatacca gactttacta tcaaatcaat aacgtggcaa       660
     atcttaaatg gtgtcacatt cctacacaag aactggatat ttcatagaga tttaaagcct       720
     gccaatatca tggtgtcaag ttcaggagtg gtgaagatcg gtgacttggg tttggcaaga       780
     aaatttaaca accctttgca aagtctctac accggagata aagtggttgt gaccatttgg       840
     tatagagctc ctgaattatt attgggtgct agacattata cgccttcaat agatttgtgg       900
     gccgtaggat gtatattagc ggaattgttg tcattgcggc caatctttaa aggagaggaa       960
     gcaaaaatag acatgaataa taagaaactg gtcccattcc aaaagaatca attacagaaa      1020
     attgttgaag tactagggac tcctacaact aagaattggc caacaatcac taaatacccc      1080
     gagtattcag catttcaaca acatttctct aatacttatc caccaaactt aattagttgg      1140
     tataagctaa ttggaagaac cagcaaacaa tgtttaaatt tgctaaggtg cttgttagag      1200
     tatgatccaa ccatacggat aactgctgac gatgcgctaa cacatgcgtt ctttttagag      1260
     ttgcccaaga tgagtgaaaa ttcctttgaa ggattaagcc aaaaatatcc aaagagaagg      1320
     atatatactc atgaaaacga tattgtatca aatctgcaac atgttaacaa caaaagacat      1380
     ggttatgatg acaacatgac aagaaagaga cagaggtaa                             1419
//

If you have problems or comments...

PBIL Back to PBIL home page