(data stored in ACNUC6288 zone)

EMBL: CR382138.PE388

CR382138.PE388       Location/Qualifiers
FT   CDS_pept        769783..770382
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F08954g"
FT                   /old_locus_tag="DEHA0F09845g"
FT                   /old_locus_tag="DEHA-IPF8354"
FT                   /old_locus_tag="DEHA-CDS5370.1"
FT                   /product="DEHA2F08954p"
FT                   /note="weakly similar to uniprot|Q02685 Saccharomyces
FT                   cerevisiae YPL024W RMI1 Protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F08954g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89092"
FT                   /db_xref="InterPro:IPR013894"
FT                   /db_xref="InterPro:IPR042470"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BM20"
FT                   /protein_id="CAG89092.2"
FT                   /translation="MDNLQQATRNSFEPQQYLQAKATYTQHPILFHIIQVADISRSRLN
FT                   QLDEWQEYEDPNSVSVDRVSKFNNKKYSGNRIIREVDMNTDNGMNRDNSKHFGGIYKLT
FT                   LKDNFENYCFAYEYNDCLQFLRSNSSTGTPLGIPLGGRLLVKKGTLVMNGAIMLKKIQC
FT                   QYLGIDENDKTLSEKLNSGIVKKHIDLLNEELTSNP"
     atggataatt tacaacaagc aactagaaat tcgttcgaac ctcagcaata tttgcaagca        60
     aaggcaactt acacccaaca tcctatacta tttcatataa tacaagttgc tgatatttcc       120
     agatcgcgtt tgaaccaatt agatgaatgg caagaatatg aagatccaaa tagtgtatcg       180
     gtagaccgag taagtaaatt caacaacaag aaatacctgg gtaatcgcat aattagagaa       240
     gttgatatga atacagataa tggaatgaat agagataatt ctaaacattt tggaggcata       300
     tataagttga cgttgaaaga caattttgaa aactactgct ttgcctacga atataatgac       360
     tgtttgcaat tcttacgact gaacagttct acggggacac ctttaggtat cccattggga       420
     ggtagacttc ttgtgaagaa aggtactctt gttatgaacg gtgccataat gttgaagaaa       480
     atacaatgtc aatatttggg aattgatgaa aatgataaga ctctttcaga aaaattgaat       540
     agcggaatag ttaagaaaca cattgatttg ctaaatgaag aacttacttc gaatccttga       600
//

If you have problems or comments...

PBIL Back to PBIL home page