(data stored in ACNUC6288 zone)

EMBL: CR382138.PE40

CR382138.PE40        Location/Qualifiers
FT   CDS_pept        91694..93517
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F01034g"
FT                   /old_locus_tag="DEHA0F01221g"
FT                   /old_locus_tag="DEHA-IPF9026"
FT                   /old_locus_tag="DEHA-CDS1591.1"
FT                   /product="DEHA2F01034p"
FT                   /note="similar to uniprot|P43550 Saccharomyces cerevisiae
FT                   YFL053W DAK2 Dihydroxyacetone kinase required for
FT                   detoxification of dihydroxyacetone (DHA)"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F01034g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88710"
FT                   /db_xref="GOA:Q6BN14"
FT                   /db_xref="InterPro:IPR004006"
FT                   /db_xref="InterPro:IPR004007"
FT                   /db_xref="InterPro:IPR012734"
FT                   /db_xref="InterPro:IPR036117"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BN14"
FT                   /protein_id="CAG88710.1"
FT                   /translation="MSLAKHWGYSKDLVLENLKGLAAANPKISLIPAEKTVVYNDSLQS
FT                   KGNKNINRIMVISGGGSGHEPLHAGFVGVNALDAAVSGSIFASPSAKQIFAAIKSISSK
FT                   QNNSKGTLVIVKNYTGDVLHFGLAVERAKAHGYKIDMIIVGDDAAVGRSKGGMVGRRAL
FT                   AATALVHKIVGSAASEIEDLSRLKILGDSVANNTVTIGATLDHCSVPGRDIANFEPIGQ
FT                   NDAEIGLGIHNETSVKKVNPVPMIDSLVQDLLEFLLNENDKDRYFVPFDLSNDETVLLV
FT                   NNLGGTSTLEMYAITNCVIETLYQQYSLRPKKVIVGEFATSLNAPGFSITLLNVSCASK
FT                   QSQISISHIMSYLDLPTDAPGWKAHPCGFGLERDINIETSINGIDSFVKSQLKLSREQQ
FT                   TDFRSSLVNGLEKLLDKEPSITFYDTVAGDGDCGETLASGANGILESLRNNEICFEDPV
FT                   YSISQIANIVEDKMGGTSGGLYSIFLTSLIKHLQDCTTLNLCEMFASSLHNALYQGLYK
FT                   YTRARVGGRTLIDALEPFVNTFNDTLNFSKAAQAAIDGSESTRKLAAKFGRASYVNEQE
FT                   FKQFDEEGGLPDPGAIGLATLIAGFAGVDYN"
     atgtcgttag ctaaacactg gggatactca aaggatttgg ttttggaaaa tttaaagggt        60
     ttggctgctg caaaccccaa aatttctctt ataccagcag aaaaaacagt cgtgtataat       120
     gattccttac aatctaaagg aaacaagaat attaatcgta taatggttat ttctggagga       180
     ggttcaggcc atgaaccgtt acatgcggga tttgttggtg taaatgcatt agatgctgct       240
     gtatctggtt caatatttgc ctccccttca gccaagcaga tttttgcagc cattaagtca       300
     attagctcca aacaaaacaa ttctaaaggt actttggtaa ttgtcaaaaa ttatacagga       360
     gatgttctac attttggact tgctgtcgaa agagcaaaag cacatggcta caaaatagac       420
     atgataattg ttggtgatga cgcagctgta ggtaggtcaa agggtggaat ggttggaaga       480
     agagcattgg cagccactgc attggttcac aaaattgttg gatctgctgc ttctgaaatt       540
     gaagatctaa gcagacttaa aatattgggt gattccgttg cgaataatac ggtgaccatt       600
     ggtgccacct tagatcattg ctctgttcct gggcgtgata ttgcaaactt tgagcctatt       660
     ggccagaatg atgctgaaat aggtctaggg atacataacg aaacttcggt caagaaggta       720
     aaccctgtac caatgataga ctcattagtt caggacttat tagaattcct attaaacgaa       780
     aatgacaaag atcgttactt tgtaccattt gatctcagta atgatgaaac ggtcttgctt       840
     gtcaacaatc tcgggggtac atctacttta gaaatgtatg ctattacaaa ttgcgttatc       900
     gaaacattat accaacaata cagtttgaga ccaaaaaaag tgatagtggg agaatttgct       960
     acgtctttaa atgcccctgg gttttcgatt accttactta acgtctcttg tgcatctaaa      1020
     caatcccaaa tttccatttc acatataatg agttacttgg atttgccaac agatgcccct      1080
     ggttggaagg cacatccgtg tgggtttgga cttgaaagag acatcaatat tgagacatca      1140
     atcaatggta ttgattcttt tgtcaagtca caattaaagc tttccagaga acaacagacg      1200
     gactttagaa gcagtctagt taatgggttg gaaaaattat tagacaaaga accaagcatt      1260
     acattttatg atactgttgc tggtgatggt gactgtggtg aaaccttagc gtctggtgca      1320
     aatggaatat tggaatcatt aaggaacaac gaaatctgct ttgaagatcc agtttattcc      1380
     atatctcaaa tagcaaacat tgtagaggat aaaatgggcg gaacttcagg aggcttatat      1440
     tcaattttct taacctcgtt gataaaacac cttcaagatt gtactacatt gaacttatgt      1500
     gaaatgtttg ctagttcttt gcataatgcg ctatatcagg gcttatataa atacactagg      1560
     gcacgagtgg gtggaagaac tttgattgat gctttagagc cgtttgtgaa taccttcaac      1620
     gacactctaa atttctcaaa ggctgcccag gctgctatcg atggatctga atcgactagg      1680
     aaattagctg caaaatttgg gagagcgtct tatgtcaatg aacaagaatt taaacagttc      1740
     gacgaagaag gaggcttacc ggatccggga gctattggat tagccacctt aattgctggg      1800
     tttgccggtg ttgactataa ttaa                                             1824
//

If you have problems or comments...

PBIL Back to PBIL home page