(data stored in ACNUC6288 zone)

EMBL: CR382138.PE405

CR382138.PE405       Location/Qualifiers
FT   CDS_pept        complement(808686..809855)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F09372g"
FT                   /old_locus_tag="DEHA0F10285g"
FT                   /old_locus_tag="DEHA-IPF8320"
FT                   /old_locus_tag="DEHA-CDS3273.1"
FT                   /product="DEHA2F09372p"
FT                   /note="similar to uniprot|Q00055 Saccharomyces cerevisiae
FT                   YDL022W GPD1 NAD-dependent glycerol-3-phosphate
FT                   dehydrogenase key enzyme of glycerol synthesis essential
FT                   for growth under osmotic stress"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F09372g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89109"
FT                   /db_xref="GOA:Q6BM03"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR017751"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BM03"
FT                   /protein_id="CAG89109.1"
FT                   /translation="MSQYRANQRLQQLSNILRPNQLSAEKSLKPETPFKVAVIGSGNWG
FT                   TTIAKVLAENTAEKPDTFAKQVDMWVFQEKIDGTNLTEIINNKHENVKYLPGVKLPENL
FT                   HAEPDIVKAAQGADLLVFNLPHQFLPKICKQLKGTLKPTTRAISCLKGLEVTPDGCKLL
FT                   STYITENLGIECGALSGANLAPEVARCKWSETTVAYNIPADFKGPGKDIDSAVLKEAFH
FT                   RPYFHVNVIEDVAGVSVAGALKNIVAIAVGFVEGLGWGDNAKSAIMRVGLIETINFSNM
FT                   FFPNSKPTTFTHESAGVADLITTCSGGRNVKVGRHMSKTGESAEEAEKKLLNGQSSQGI
FT                   ITAKEVHELLSNVGKTDQFPLFEATYQIIYGDESIQNLPNLLEDHSLFK"
     atgtcacaat atagagccaa tcaaagatta caacagttat cgaatatatt acgtcctaat        60
     cagcttagtg ctgaaaaatc gttaaagcca gaaactccat tcaaggttgc tgtgattgga       120
     tccggtaact gggggactac aattgccaag gttttagccg aaaacacggc cgaaaagcca       180
     gacacttttg ctaaacaggt cgatatgtgg gttttccaag agaagattga tggtactaac       240
     ttgactgaga tcatcaacaa taagcacgaa aatgtgaaat atttgccagg ggttaagttg       300
     ccagaaaact tgcatgcaga gcctgatatc gttaaggctg cgcaaggtgc cgatttattg       360
     gtattcaact tgcctcatca atttttacct aagatctgta agcagttgaa aggtactttg       420
     aagccaacca ccagagcaat ttcgtgtttg aaagggttag aagttactcc agatgggtgc       480
     aaattgttat caacttacat tactgaaaac ttaggaatcg aatgtggtgc tttatctggt       540
     gctaacttgg ctccagaagt tgctagatgc aaatggtctg aaactactgt tgcatacaac       600
     attccagctg actttaaagg tccaggtaaa gatattgata gtgctgtttt aaaggaagca       660
     ttccacagac cttactttca tgtaaatgtt attgaagatg ttgcaggtgt ttctgtagct       720
     ggtgcattga agaacattgt tgcgattgct gtgggctttg ttgaaggatt aggctggggt       780
     gacaatgcta aatcggctat tatgagagtt ggtttaattg aaactatcaa tttttcaaat       840
     atgtttttcc caaattctaa gccaactaca ttcacccacg aatctgctgg tgttgctgat       900
     ttaatcacca cttgttccgg tggtagaaat gttaaggtcg gtagacatat gtcgaaaaca       960
     ggcgaatctg ctgaagaagc agaaaagaaa ttattgaatg gccaatcctc gcaaggtatc      1020
     atcactgcaa aggaagtcca tgagttatta agcaatgttg gtaagactga tcaattccca      1080
     ttatttgaag ctacttatca aattatatac ggtgatgaat ctattcaaaa cttgccaaac      1140
     ttattagaag accattcatt attcaaatag                                       1170
//

If you have problems or comments...

PBIL Back to PBIL home page