(data stored in ACNUC6288 zone)

EMBL: CR382138.PE408

CR382138.PE408       Location/Qualifiers
FT   CDS_pept        814492..815259
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F09438g"
FT                   /old_locus_tag="DEHA0F10351g"
FT                   /old_locus_tag="DEHA-IPF8312"
FT                   /old_locus_tag="DEHA-CDS4747.1"
FT                   /product="DEHA2F09438p"
FT                   /note="similar to uniprot|P01119 Saccharomyces cerevisiae
FT                   YOR101W RAS1 GTPase involved in G-protein signaling in the
FT                   adenylate cyclase activating pathway plays a role in cell
FT                   proliferation"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F09438g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89112"
FT                   /db_xref="GOA:Q6BM00"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR020849"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BM00"
FT                   /protein_id="CAG89112.2"
FT                   /translation="MLKEYKLVVVGGGGVGKSALTIQLIQSHFVDEYDPTIENSYRKQC
FT                   TLDGESVLLDILDTAGQEEYSAMREQYMRTGEGFLLVYSINSRTSLEELQSFYEQIQRV
FT                   KDSDFVPVLVVGNKCDLEIERQVSYEEGLSLAKSFNCPFLETSAKQRINVEEAFYGLVR
FT                   SIRDGENGAKKLETGNNDAAGVAGGSAGAGNTANQTDVAAQDNAAAAGASNKQKQASNN
FT                   VSSVANSGKRQQQQSSAAGGKEEKEKSGCCVIV"
     atgcttaagg aatataagtt agtcgtcgtc ggtggtggtg gtgtcggtaa atctgcattg        60
     accatccaat taattcaatc acattttgtt gacgaatacg atccaactat cgaaaattca       120
     taccgtaaac agtgcaccct cgacggggaa ctggttttgt tggatatttt ggatacggcc       180
     gggcaagagg aatacagtgc catgagagaa caatacatga ggaccgggga agggtttttg       240
     ttggtttatt ctatcaactc gcgtacttcg ttggaggaat tacaatcgtt ctatgagcaa       300
     atccaaaggg ttaaggactc ggatttcgtg ccggttttag tggttggtaa taagtgtgat       360
     ttggagattg aaagacaggt gagctacgaa gagggtttaa gcttggcgaa atctttcaat       420
     tgcccatttt tggaaacatc cgcaaagcaa agaattaacg tcgaggaagc gttctatggg       480
     ttggtcagat ccatcagaga cggtgaaaat ggtgctaaga agcttgaaac cggtaacaat       540
     gacgctgctg gtgtagctgg aggcagtgca ggagcaggca acactgccaa ccaaactgat       600
     gtagcagcac aagataatgc agctgctgct ggtgcttcga ataaacaaaa acaagcgtcc       660
     aataacgttt catcggttgc taatagcggt aagagacagc aacaacaatc ttctgctgct       720
     ggtggtaaag aagagaaaga aaaatctggc tgttgtgtta tcgtctaa                    768
//

If you have problems or comments...

PBIL Back to PBIL home page