(data stored in ACNUC6288 zone)

EMBL: CR382138.PE410

CR382138.PE410       Location/Qualifiers
FT   CDS_pept        816165..816755
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F09482g"
FT                   /old_locus_tag="DEHA0F10395g"
FT                   /old_locus_tag="DEHA-IPF8310"
FT                   /old_locus_tag="DEHA-CDS5404.1"
FT                   /product="DEHA2F09482p"
FT                   /note="similar to uniprot|P50946 Saccharomyces cerevisiae
FT                   YNL099C OCA1 Putative protein tyrosine phosphatase required
FT                   for cell cycle arrest in response to oxidative damage of
FT                   DNA"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F09482g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89114"
FT                   /db_xref="GOA:Q6BLZ8"
FT                   /db_xref="InterPro:IPR004861"
FT                   /db_xref="InterPro:IPR020428"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BLZ8"
FT                   /protein_id="CAG89114.1"
FT                   /translation="MSESQSEIEHNNNNSKLTKISQPPTVRIIPPLNFCPVEKQLYRSG
FT                   QPSIINQSFLQDLNLKTILWLASEEPQEDFLDYCSMNNIAVEFVGLMNEYSYQNVNPWD
FT                   ALSEDTIKKALELICNKENYPLLVCCGMGRHRTGTVIGCLRRLQGWNLASVSEEYRRFT
FT                   GSRGGRIMVELLIESFDINSVQIDPTKMPGWLT"
     atgagtgaat cacaatcaga aattgagcat aataataata actcgaaatt gactaaaatt        60
     agccaacctc ctacggttag aataataccg ccgttaaatt tttgcccagt agaaaagcaa       120
     ctttacaggt caggacagcc atcaatcata aatcagtcct tcttgcaaga cttgaattta       180
     aaaaccatac tatggttggc cagtgaggag ccacaggaag actttttgga ttattgttca       240
     atgaacaata ttgcggttga gttcgttggc ttaatgaacg aatattccta ccagaatgtg       300
     aacccatggg atgcattaag cgaagatacc ataaagaaag cattggaatt gatatgcaac       360
     aaagaaaact atccgctatt agtgtgctgc ggaatgggaa gacatagaac gggaactgtt       420
     atagggtgtc ttaggcgttt acaggggtgg aatcttgcca gcgtaagtga agagtacaga       480
     agatttactg gttcgagggg aggacgtatt atggtcgaat tactcattga aagttttgat       540
     ataaactcag tccagataga tcctacaaaa atgcccggat ggcttacatg a                591
//

If you have problems or comments...

PBIL Back to PBIL home page