(data stored in ACNUC6288 zone)

EMBL: CR382138.PE414

CR382138.PE414       Location/Qualifiers
FT   CDS_pept        823183..824382
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F09570g"
FT                   /old_locus_tag="DEHA0F10483g"
FT                   /old_locus_tag="DEHA-IPF8304"
FT                   /old_locus_tag="DEHA-CDS3195.1"
FT                   /product="DEHA2F09570p"
FT                   /note="similar to uniprot|P06168 Saccharomyces cerevisiae
FT                   YLR355C ILV5 Acetohydroxyacid reductoisomerase
FT                   mitochondrial protein involved in branched-chain amino acid
FT                   biosynthesis also required for maintenance of wild- type
FT                   mitochondrial DNA"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F09570g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89118"
FT                   /db_xref="GOA:Q6BLZ4"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR016207"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BLZ4"
FT                   /protein_id="CAG89118.1"
FT                   /translation="MSIRNASIRMARMASNNAAKQVASKRALSALANAARPVVARKSIA
FT                   PAAARGVKTINFGGMDEIVHERADWPREKLLEYFKNDTLALIGYGSQGYGQGLNLRDNG
FT                   LNVIIGVRKDGASWKAAIEDGWVPGENLFDVNEAIGKGTYIMNLLSDAAQSETWESIKP
FT                   QLTEGKTLYFSHGFSPVFKELTHVEPPTNIDVILAAPKGSGRTVRTLFKEGRGINSSYA
FT                   VWNDVTGKAEEKAIALAVAIGSGYVYQTTFEREVNSDLYGERGCLMGGIHGMFLAQYEV
FT                   LRENGHTPSEAFNETVEEATQSLYPLIGKYGMDYMYDACSTTARRGALDWYPRFKDALK
FT                   PVFNDLYESVKNGTETQRSLDFNSQSDYRARLEEELETIRSMEIWRVGKEVRKLRPENQ
FT                   "
     atgtctatca gaaacgcttc tattcgtatg gcccgtatgg cctccaacaa tgctgctaag        60
     caagttgctt ccaagagagc tttatcagct ttagctaatg ctgctcgtcc agttgttgcc       120
     agaaagtcaa ttgctccagc tgctgcccgt ggtgttaaga ccatcaactt cggtggtatg       180
     gatgaaattg tccacgaacg tgctgactgg ccaagagaaa agttattaga gtacttcaag       240
     aacgatactt tagctttaat tggttacggt tcccaaggtt acggtcaagg tttaaacttg       300
     agagacaatg gtttaaacgt tatcattggt gttagaaagg atggtgcttc atggaaggct       360
     gccatcgaag atggatgggt tccaggtgaa aacttattcg atgtcaacga agctatcggt       420
     aagggtactt acatcatgaa cttgttatct gatgctgctc aatctgaaac ttgggaatct       480
     atcaagccac aacttactga aggtaagacc ttatactttt cccacggttt ctctccagtt       540
     ttcaaggaat taacccacgt tgaaccacca accaacattg acgttatctt agctgctcca       600
     aagggttccg gtagaactgt cagaacctta tttaaggaag gtagaggtat caactcttct       660
     tacgctgtct ggaacgatgt taccggtaag gccgaagaaa aggctatcgc tttagctgtt       720
     gccattggtt ctggttacgt ttaccaaacc accttcgaaa gagaagtcaa ctccgattta       780
     tacggtgaaa gaggttgttt aatgggtggt atccacggta tgttcttagc ccaatacgaa       840
     gtcttaagag aaaatggcca caccccatct gaagctttca acgaaactgt tgaagaagcc       900
     actcaatcct tatacccatt gatcggtaaa tacggtatgg actacatgta cgatgcttgt       960
     tctaccaccg ccagaagagg tgctttagac tggtacccaa gattcaagga tgccttgaag      1020
     ccagttttca acgacttgta cgaatctgtt aagaacggta ccgaaaccca aagatctctt      1080
     gatttcaact ctcaatctga ctaccgtgct agattagaag aagaattaga aaccatcaga      1140
     agcatggaaa tctggagagt cggtaaggaa gttagaaaat tacgtccaga aaaccaatag      1200
//

If you have problems or comments...

PBIL Back to PBIL home page