(data stored in ACNUC6288 zone)

EMBL: CR382138.PE42

CR382138.PE42        Location/Qualifiers
FT   CDS_pept        complement(97098..98558)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F01078g"
FT                   /old_locus_tag="DEHA0F01287g"
FT                   /old_locus_tag="DEHA-IPF9021"
FT                   /old_locus_tag="DEHA-CDS2279.1"
FT                   /product="DEHA2F01078p"
FT                   /note="similar to uniprot|Q07376 Saccharomyces cerevisiae
FT                   YDL054C MCH1 Protein"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F01078g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88713"
FT                   /db_xref="GOA:Q6BN11"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BN11"
FT                   /protein_id="CAG88713.2"
FT                   /translation="MLKHKTFINRISHSIKHYLSFHVSIANLKKISFFISLFSCLTSGS
FT                   IMLFSLFSSSLHELYGINYLHINFIASLSAIGMYLCLPVLGYLADCYGPSLLSLISIWF
FT                   FVPSYFVNSQVIKSLEYNNVMKIHLYAFGICFFFIGLATSSLYFSSLLTCAKIYPEHKG
FT                   LAISLPVTCYGLSTLLGSQLMKLSYFKQYNGFLNLHKVFNFFGVLYLVMGILNFVSSSV
FT                   VSMESEIIFTNEDEMEEADEESPLMTSRSRHSHHSCEDDDNLIPERSIIEPLKHQERFI
FT                   NFLKDKSAWLLLASLILNIGPMESFQNNLGSIIINSNSESNLSDQVSIMAASSTVTRLA
FT                   MGGLSDYLSSSKRKFPICRVNLLIINLAIGIVGQFMVTRSTRFSIVSILNGSSYGGLFT
FT                   IYPTIVASIWGIDMMGSTWGSFMIAPAIGSIGFSIFYGNEVDNKCGVDYSSCLQHYFNL
FT                   TAVGLSVSLILIIIVWKGIWAKRGYRVF"
     atgcttaaac ataaaacttt cataaatagg atttctcatt ctatcaagca ttatctatca        60
     ttccacgttt caattgcaaa cttgaaaaag atatcattct ttatatcctt attctcatgt       120
     cttacatccg gatcaataat gctattttca ctattttcgt catcattaca tgaattatat       180
     ggcataaatt acctacatat caacttcatt gcgtcattat ctgctattgg gatgtactta       240
     tgtctacctg tgctaggcta tttggctgat tgctacggtc cctcattact ttcgctaatt       300
     ctgatctggt tttttgttcc cagttatttt gttaattccc aagttattaa aagtctcgaa       360
     tataacaatg tgatgaagat ccacttatat gcatttggaa tttgtttttt cttcatagga       420
     ttggctacat cgtcattata ctttctgagc ttgttgacct gcgcaaaaat ttatcccgaa       480
     cataaaggtt tggctatatc attacctgtt acatgctatg gattatcgac gttattagga       540
     tcgcagttga tgaaactctc ttatttcaaa cagtataatg ggtttttgaa cttgcacaag       600
     gtgttcaatt tctttggcgt tctatacttg gtgatgggaa tattgaattt cgtatcgagc       660
     tctgttgtta gcatggagtc agagattata tttacaaatg aagacgaaat ggaggaagca       720
     gatgaagaac tgccattaat gacatctaga tcaagacatt cacaccacag ctgcgaagat       780
     gacgacaact taattcctga acggtcaata attgaaccac ttaagcacca agaacggttt       840
     attaattttt tgaaggacaa atctgcatgg ttactattag cctccttaat attgaatatt       900
     ggccccatgg aaagttttca gaataatttg ggttcaatca ttataaatag caattctgag       960
     agtaacctat ctgaccaagt cagcataatg gctgcatcat cgacagtcac tagattggct      1020
     atgggagggt tgtcggatta tttatcctcc agtaagagaa aattcccaat atgtcgtgtc      1080
     aatttgttga tcatcaattt ggccatcgga atagttggcc aattcatggt gacgagactg      1140
     actcgttttt cgatagtatc tattttgaat ggttcgtcgt atggtgggtt attcaccata      1200
     tatcctacta tcgtcgcctc gatatggggg atcgacatga tggggtctac ttggggctcg      1260
     ttcatgatag ctcctgctat cgggtcgatt ggattttcga ttttctacgg gaatgaggtt      1320
     gataacaaat gcggtgtcga ctactcaagc tgtttgcagc attatttcaa cctcaccgct      1380
     gttgggttat cggtgagctt gatcttgata ataatcgtct ggaaaggaat atgggcaaaa      1440
     cgcggatata gggtttttta g                                                1461
//

If you have problems or comments...

PBIL Back to PBIL home page