(data stored in ACNUC6288 zone)

EMBL: CR382138.PE420

CR382138.PE420       Location/Qualifiers
FT   CDS_pept        complement(834319..835467)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F09702g"
FT                   /product="DEHA2F09702p"
FT                   /note="similar to uniprot|Q12006 Saccharomyces cerevisiae
FT                   YOL003C DHHC-CRD protein"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F09702g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66308"
FT                   /db_xref="GOA:Q6BLY8"
FT                   /db_xref="InterPro:IPR001594"
FT                   /db_xref="InterPro:IPR033682"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BLY8"
FT                   /protein_id="CAR66308.1"
FT                   /translation="MVAYGSHYFVFRTNLSRTEQILYEVYVCIVWLSYYLAIVVDPGSP
FT                   PKNFTPKAGEWRRWCKKCQNYKPERSHHCKTCNKCVLKMDHHCPWTYNCVGHNNLPHFL
FT                   RFVFFLIVGMTYVLFQLGKQVLHYYDSSKLPSYLIDKKEMCAVIFLLPVTFFVFVSIII
FT                   LFVRCMINLLFRGMTQIEVWEMERIGSQFHTERLWLQIRKNYFKLHGKEMPHLVSWNRT
FT                   TRYYEVDENSNNDNSNENNIVPKDFTSDDIVFPYDLGVSSNMINACDYPWMWLLPWGGP
FT                   RENGYHFQKNEFMEDDQLGLPWPPDGGHQEPMAPVDDDFDISDSELQDMPSLRRRLDPR
FT                   NNMTRSEWMNDLGETLDDFGVDLDAEDIEHDDLVSKDEISNN"
     atggttgcat atggttccca ctactttgta ttcagaacca acttatcacg taccgagcag        60
     atcctatacg aggtatacgt ttgtattgta tggttatcat actatttagc tattgttgtt       120
     gacccaggat ccccgcctaa aaactttaca cctaaagctg gagaatggag aagatggtgt       180
     aagaaatgcc aaaattataa gccagagagg tcacatcatt gcaaaacttg caataaatgt       240
     gtgttgaaaa tggatcatca ttgtccatgg acgtataatt gcgtggggca caataacctt       300
     ccacatttct tacggtttgt attctttttg atagtgggta tgacctatgt tcttttccaa       360
     ttgggtaaac aagtacttca ttattatgat agtagtaagt taccgtccta cttaatagac       420
     aagaaggaaa tgtgtgcggt gatattttta cttccagtta cattttttgt atttgtttcc       480
     atcattattt tattcgttcg ttgtatgatc aacttgttgt tcagaggaat gacgcagata       540
     gaagtatggg aaatggagag aataggatcc cagttccata ccgaaaggtt gtggttgcaa       600
     atacgtaaaa actacttcaa gttgcatgga aaagaaatgc ctcatttagt atcctggaac       660
     aggacaacca gatactacga ggtggatgag aattctaata atgacaattc aaatgagaac       720
     aacatagtcc ctaaggattt cacatctgat gatatcgttt tcccctatga cttaggcgtg       780
     ctgtcgaata tgattaatgc atgtgactac ccatggatgt ggctactccc atggggtggt       840
     cccagagaaa acggctacca tttccaaaaa aacgaattca tggaagatga ccaattgggc       900
     ttaccatggc ctcctgacgg gggccaccag gaaccaatgg ctccagtgga cgatgatttt       960
     gatatatctg actccgagct tcaggatatg cctagcttaa gaagacgtct cgaccccaga      1020
     aacaacatga cgaggtccga atggatgaac gatctaggcg aaaccttgga tgattttggc      1080
     gttgatttag atgctgaaga catagaacat gatgatttag tttcaaaaga tgagatttcc      1140
     aataattag                                                              1149
//

If you have problems or comments...

PBIL Back to PBIL home page