(data stored in ACNUC6288 zone)

EMBL: CR382138.PE421

CR382138.PE421       Location/Qualifiers
FT   CDS_pept        join(835802..835804,835868..835916,835999..836726)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F09724g"
FT                   /old_locus_tag="DEHA0F10637g"
FT                   /old_locus_tag="DEHA-IPF8294"
FT                   /old_locus_tag="DEHA-CDS5010.1"
FT                   /product="DEHA2F09724p"
FT                   /note="highly similar to uniprot|P21242 Saccharomyces
FT                   cerevisiae YOR362C PRE10 20S proteasome alpha-type subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F09724g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89125"
FT                   /db_xref="GOA:Q6BLY7"
FT                   /db_xref="InterPro:IPR000426"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR023332"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR037555"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BLY7"
FT                   /protein_id="CAG89125.2"
FT                   /translation="MTSIGTGYDLSNSVFSPDGRNFQVEYAMKAVENGGTSIGIKCKDG
FT                   IVLAVEKIINSKLLVPGKNKRIQTIDRHIGVAYSGLLPDGRHFVNRGRDEAQNFKNIYK
FT                   TPISVPHLMDRLGIYIQNYTCYNSVRPFGIVSIVGGVDENGPHLYMIEPSGTCWGYTGA
FT                   ATGKGRQTAKSELEKLNFEELTVKEAVKVAAKIIHQAHEDNKDKDYELEISWCSKEETS
FT                   CRHESVPDALLQEAIKLAQEEDEEEEDDDEEDAEMES"
     atgacttcta tcggtacagg ttacgattta tcaaatagtg ttttttcacc agatggaaga        60
     aattttcaag tagaatatgc catgaaagct gttgaaaatg gtggtacatc tatcggaatt       120
     aaatgtaaag atggtatagt attagcggtt gaaaagatca taaattccaa attgttggtt       180
     ccaggaaaga ataagagaat ccagacaatt gatagacata ttggtgttgc atattcagga       240
     cttttgcctg atggacgtca ttttgtaaat agaggtaggg atgaagcaca aaatttcaag       300
     aacatataca agactccaat ttctgttcca cacttgatgg atcgtttggg aatctatatc       360
     cagaattaca cttgttacaa ctccgttaga ccattcggaa ttgtgtctat tgttgggggt       420
     gttgacgaga acggaccaca tttatatatg attgaaccaa gtgggacatg ctggggttac       480
     acgggtgctg ccaccggtaa ggggagacaa actgccaagt ccgagctaga aaaattgaac       540
     ttcgaagagt tgacagttaa ggaagctgtg aaagttgctg ccaaaattat ccaccaagct       600
     cacgaagata acaaagacaa agattatgaa ttagaaattt catggtgttc aaaagaggag       660
     acctcatgca gacatgaatc tgttcctgat gcgttattac aagaagccat caagttagct       720
     caagaagagg atgaagaaga agaagatgat gatgaagaag acgcagaaat ggaaagctag       780
//

If you have problems or comments...

PBIL Back to PBIL home page