(data stored in ACNUC6288 zone)

EMBL: CR382138.PE43

CR382138.PE43        Location/Qualifiers
FT   CDS_pept        complement(98790..99815)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F01100g"
FT                   /old_locus_tag="DEHA0F01309g"
FT                   /old_locus_tag="DEHA-IPF9017"
FT                   /old_locus_tag="DEHA-CDS3912.1"
FT                   /product="DEHA2F01100p"
FT                   /note="highly similar to uniprot|P09201 Saccharomyces
FT                   cerevisiae YLR377C FBP1 Fructose-1 6-bisphosphatase key
FT                   regulatory enzyme in the gluconeogenesis pathway required
FT                   for glucose metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F01100g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88714"
FT                   /db_xref="GOA:Q6BN10"
FT                   /db_xref="InterPro:IPR000146"
FT                   /db_xref="InterPro:IPR020548"
FT                   /db_xref="InterPro:IPR028343"
FT                   /db_xref="InterPro:IPR033391"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BN10"
FT                   /protein_id="CAG88714.2"
FT                   /translation="MSTQHNSVSEQMNVDTDIITLTRFILQEQQKEAPNATGELSLLLN
FT                   SLQFAFKFIAHNIRRAELVNLIGISGSANSTGDVQKKLDVIGDEIFINAMKSSNNVKVL
FT                   VSEEQEDLIVFEGGGRYAVCTDPIDGSSNIDAGVSVGTIFGIYRLKEDSQGSIKDVLRK
FT                   GTEMVAAGYTMYGASAHLMLTTGQGVNGFTLDTQLGEFILTQPHLTIPKTRAIYSVNEG
FT                   NSHYWADSAKQYIADLKKPQEDGKPYSARYIGSMVADIHRTILYGGIFAYPADSKSKNG
FT                   KLRILYECFPMAMLMEQAGGAAINDKGERILEILPKGIHDKSGIWLGSTGEVDRYLTYL
FT                   K"
     atgtccacac aacacaattc agtctctgaa cagatgaacg tcgacaccga catcatcacg        60
     ttgaccagat ttattttgca agaacagcaa aaagaagccc caaatgctac tggtgaattg       120
     tcattgttat taaactcgtt acaatttgct ttcaaattca ttgctcacaa cattagaaga       180
     gccgaattgg tcaatttgat tggtatcagt ggtagtgcta actctactgg tgatgttcaa       240
     aagaaattgg atgtgattgg agatgaaatt ttcatcaatg ctatgaaatc gtcgaacaac       300
     gtcaaagttt tagtttcaga ggaacaagaa gacttgattg ttttcgaagg aggtggacgt       360
     tatgctgttt gtaccgatcc aattgacgga tcgtctaata ttgatgctgg tgtttctgtt       420
     ggtactatct tcggtatcta tagattgaag gaagattctc agggatccat caaggatgtg       480
     ttgagaaagg gtaccgaaat ggttgctgct ggttacacta tgtacggtgc ttctgctcac       540
     ttaatgttga ccacaggaca aggtgtcaac ggcttcactt tggatacaca attgggtgaa       600
     ttcattttga ctcaaccaca cttgaccatt cctaagacca gagctattta ctctgtcaac       660
     gaaggtaact ctcattactg ggctgacagt gccaaacaat atatcgcaga cttgaagaag       720
     ccacaagaag atggaaagcc ttacagtgca agatacattg gttctatggt tgctgatatt       780
     cacagaacta tattgtacgg tggtattttc gcatatccag ctgattctaa gctgaaaaat       840
     ggtaagttaa gaattttata tgaatgtttc ccaatggcta tgttgatgga acaagccggt       900
     ggtgcagcca ttaacgataa gggtgaaaga atcttagaaa ttttgccaaa aggaatccat       960
     gacaagagtg gtatctggtt aggctcaacc ggtgaagttg atagatactt aacttacctc      1020
     aaataa                                                                 1026
//

If you have problems or comments...

PBIL Back to PBIL home page