(data stored in ACNUC6288 zone)

EMBL: CR382138.PE431

CR382138.PE431       Location/Qualifiers
FT   CDS_pept        join(858158..858210,858292..858607)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F09944g"
FT                   /product="DEHA2F09944p"
FT                   /note="similar to uniprot|P38902 Saccharomyces cerevisiae
FT                   YOL005C RPB11 RNA polymerase II subunit B12.5"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F09944g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89138"
FT                   /db_xref="GOA:Q6BLX4"
FT                   /db_xref="InterPro:IPR008193"
FT                   /db_xref="InterPro:IPR009025"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR037685"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BLX4"
FT                   /protein_id="CAG89138.1"
FT                   /translation="MNAPDRFELFILPDGVDKIKITPDTKVPNAALIKIEREDHTLGNL
FT                   IRAQLLKDERVLFAAYKVEHPLFANFVLRIQTEDDYSPREALRNACSGLIGELDVIKTR
FT                   FKDEWALKSLLNSNDDDF"
     atgaacgcac cagatagatt cgagcttttc attttaccag atggagtgga caagattaag        60
     ataactcccg acacgaaggt gcctaatgca gcattgatca agattgaaag ggaggaccac       120
     actttgggaa atttgatcag agcacaatta ttgaaggatg aaagagtgtt attcgccgct       180
     tacaaggttg agcatccatt atttgctaat tttgtattga gaatccagac agaagacgat       240
     tattcaccta gagaagcatt aaggaacgct tgttctgggt tgattgggga attggatgtt       300
     atcaagacaa gatttaagga tgaatgggca cttaaatcat tgttgaacag taacgacgac       360
     gacttttag                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page