(data stored in ACNUC6288 zone)

EMBL: CR382138.PE434

CR382138.PE434       Location/Qualifiers
FT   CDS_pept        complement(864962..866206)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F10010g"
FT                   /old_locus_tag="DEHA0F10967g"
FT                   /old_locus_tag="DEHA-IPF8269"
FT                   /old_locus_tag="DEHA-CDS3058.1"
FT                   /product="DEHA2F10010p"
FT                   /note="similar to uniprot|O59832 Schizosaccharomyces pombe
FT                   SPCC965 SPCC965.12 protein"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F10010g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89141"
FT                   /db_xref="GOA:Q6BLX1"
FT                   /db_xref="InterPro:IPR008257"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BLX1"
FT                   /protein_id="CAG89141.2"
FT                   /translation="MVGKHIDEDLIKRFETLSSETPIVDTHNDFPYLLRVQLHNEFETV
FT                   NRFKFDDKLQSHTDLGKFRRGRVGLQFFSCFIECKDDDYLYQDFNNPNSAVRDTMEQID
FT                   VVTRLVSSYSEDLEMVSMSSQVMDVYSNGKIAISMGVEGLHQVDSSLSVLRKYYELGVR
FT                   YITLTHNCDNPFATAASSVVAGLPDNGLSDFGRSCVLEMNRIGMMVDLSHVSYKTMLDA
FT                   LEITKAPVMFSHSSAYTMTPNERNVRDDVLLRLKENNGVICINFFPSFISPHSDENAII
FT                   DDAVNHIKHVVELIGWEHVGLGSDFDGIPEGPKGLEDVSKYPDLIIKVMGNLNASDSQI
FT                   RLLMGDNVLRVWNENEKVAKSLQIAGTQLVNENWQKRDWSFFDYARSFRELYPGAYEEK
FT                   TNTYKDASLDLTKEK"
     atggtaggga agcacattga tgaagatttg atcaaaagat ttgagaccct aagcagcgaa        60
     acccctatcg tcgataccca taatgatttt ccttacttgt taagagttca attacataat       120
     gagtttgaga cagtaaatag atttaaattt gatgacaagt tgcaaagtca tactgatcta       180
     ggcaaattca gacgaggcag ggttggatta caatttttca gctgctttat tgaatgcaag       240
     gatgatgatt atttatatca agacttcaat aatccaaaca gtgcagttag agataccatg       300
     gaacaaattg atgttgttac acgtttagtc agctcctatc tggaggactt ggagatggtg       360
     ctgatgtctc tgcaagtgat ggatgtttat tccaatggga aaattgctat ttctatgggg       420
     gttgaaggat tgcatcaagt ggatagctct ctaagtgtat taagaaagta ttacgagttg       480
     ggagtacgtt atataacttt gacacataat tgtgacaacc catttgccac tgctgcctct       540
     tcggtggttg ctggtttacc agataacggt ctttctgact ttggaagatc ttgtgtccta       600
     gaaatgaaca gaataggcat gatggtagat ctatctcatg taagttataa gaccatgctt       660
     gatgcattag agataactaa agctccggta atgttttctc attcgtctgc ttatactatg       720
     accccaaacg aaagaaatgt aagggacgat gtgttgttaa ggttgaaaga aaataatgga       780
     gtaatttgca taaacttttt cccttcgttt atcagtcccc acagtgacga aaatgccatt       840
     atagatgatg cagtaaatca tataaagcat gttgttgaat taattggttg ggaacatgtt       900
     ggacttggat ctgatttcga tggaattcct gaaggtccaa agggtcttga agatgtgtcc       960
     aaatatccgg acttgataat taaggtcatg ggtaacttaa acgcatcaga tagtcagata      1020
     cgattgttaa tgggtgataa cgttttgagg gtttggaatg aaaacgagaa ggttgctaaa      1080
     tcgttgcaaa tagcaggcac acagcttgtg aacgaaaatt ggcagaagag agattggagt      1140
     ttctttgatt atgcaagaag tttccgtgaa ctttatcctg gtgcttatga ggagaaaact      1200
     aacacatata aagacgcctc tctcgatcta acgaaagaaa agtaa                      1245
//

If you have problems or comments...

PBIL Back to PBIL home page