(data stored in ACNUC6288 zone)

EMBL: CR382138.PE443

CR382138.PE443       Location/Qualifiers
FT   CDS_pept        880434..880871
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F10230g"
FT                   /old_locus_tag="DEHA0F11187g"
FT                   /old_locus_tag="DEHA-IPF8252"
FT                   /old_locus_tag="DEHA-CDS6190.1"
FT                   /product="DEHA2F10230p"
FT                   /note="similar to uniprot|Q00381 Saccharomyces cerevisiae
FT                   YJR058C APS2 Small subunit of the clathrin-associated
FT                   adaptor complex AP-2 which is involved in protein sorting
FT                   at the plasma membrane"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F10230g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89150"
FT                   /db_xref="GOA:Q6BLW2"
FT                   /db_xref="InterPro:IPR000804"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="InterPro:IPR016635"
FT                   /db_xref="InterPro:IPR022775"
FT                   /db_xref="InterPro:IPR027156"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BLW2"
FT                   /protein_id="CAG89150.2"
FT                   /translation="MAIHFILVLNRQGKTRLAKWFDNNYTTQDKQRYTTEIHRLISSRD
FT                   SKYQSNFIEYQQNKLVYRRYAGLYFISSIDLIDSELDSLESLHFLVEVLDVYFDNVCEL
FT                   DLIFNFYKLYSILDEIFLGGEFQEISKDKILERLAYLDKLD"
     atggctattc atttcattct agtgcttaac aggcagggta aaacaaggct tgctaagtgg        60
     tttgataata actatactac ccaggataag caaagatata caacagagat acataggttg       120
     atatcttcta gggacctgaa atatcagtcc aattttattg aataccaaca gaacaagttg       180
     gtctacaggc gatacgctgg attgtatttt atatcttcca tagatctcat tgacagtgaa       240
     ttggattcgt tagagtcgct acattttttg gtggaagtgt tagacgttta tttcgataat       300
     gtttgtgaac tagacttaat atttaacttc tataaattgt attctatatt agatgaaata       360
     ttcttgggag gagagtttca agagatactg aaggataaaa tcttggaaag gttggcatat       420
     ttagacaaat tagactag                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page