(data stored in ACNUC6288 zone)

EMBL: CR382138.PE451

CR382138.PE451       Location/Qualifiers
FT   CDS_pept        896686..896943
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F10406g"
FT                   /old_locus_tag="DEHA0F11363g"
FT                   /old_locus_tag="DEHA-IPF8237"
FT                   /old_locus_tag="DEHA-CDS7679.1"
FT                   /product="DEHA2F10406p"
FT                   /note="similar to uniprot|Q6MVW1 Neurospora crassa B15B3
FT                   Hypothetical protein B15B3.030"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F10406g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89158"
FT                   /db_xref="GOA:Q6BLV4"
FT                   /db_xref="InterPro:IPR009846"
FT                   /db_xref="InterPro:IPR017089"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BLV4"
FT                   /protein_id="CAG89158.1"
FT                   /translation="MADKVKDINQYNQLKSKYIGLGNADITREEFMTNVNRDIYSSLAQ
FT                   HDNILYYNSVIINEPMELLRQKMIKKMASPIQNNAKKPEN"
     atggcagata aggtaaaaga cataaatcaa tataatcaat tgaaatctaa atatatcgga        60
     cttggaaatg ctgatatcac gagggaagaa tttatgacaa atgtcaatcg ggatatatat       120
     tcatcgttgg cacaacatga taatatttta tactataatt ctgtaattat taacgagcca       180
     atggaattat tgagacagaa gatgattaaa aagatggcaa gccccattca gaacaatgca       240
     aaaaagcctg agaattga                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page