(data stored in ACNUC6288 zone)

EMBL: CR382138.PE452

CR382138.PE452       Location/Qualifiers
FT   CDS_pept        complement(897253..898083)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F10428g"
FT                   /old_locus_tag="DEHA0F11385g"
FT                   /old_locus_tag="DEHA-IPF8236"
FT                   /old_locus_tag="DEHA-CDS4509.1"
FT                   /product="DEHA2F10428p"
FT                   /note="similar to uniprot|Q7SAH3 Neurospora crassa NCU06977
FT                   Predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F10428g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89159"
FT                   /db_xref="GOA:Q6BLV3"
FT                   /db_xref="InterPro:IPR013920"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BLV3"
FT                   /protein_id="CAG89159.2"
FT                   /translation="MAINQPEQLITHKVTTIVSLVLSIYGNLRYLVGRSPFDSDSPFNV
FT                   SNTPFSSNILVTLIYWGILYLLQIIFVSQIFIPAQESARARVEYSQLVGWHFTIFNFAQ
FT                   FIWSMLFARRHFILSEIVLLINFFNILSLYYSHKTYSIKPLSNWILIHLPTTALPLSWL
FT                   FYAIFWNGAVMFHIHKFVGRVVCNVLIWDFLIVPAMFILFYNDYGVGLSSSVLMFGLGL
FT                   GQLLTKAFALQWIFAFVIASILLVLSLTAAVAGSYYVKQDTRITDSEAAPLLSN"
     atggcaataa atcaaccaga gcagttaatt actcataaag tgactacgat tgtttcgttg        60
     gtattatcaa tctacggtaa tttgcgttat ttagttggta gatctccttt tgattcagac       120
     agtccattca atgttagcaa cacacctttt tcatcaaaca tattagttac attgatatac       180
     tggggtatat tatacttact tcaaatcatt tttgttagtc agatttttat tcctgcccaa       240
     gaactggcta gagcaagagt tgagtattca caattagtcg gatggcactt cactattttc       300
     aactttgcac aatttatttg gtcaatgttg tttgctagaa gacatttcat tttgagtgaa       360
     atcgtattat tgatcaactt cttcaatatt ttatcactct actacagtca caaaacttac       420
     agtatcaaac ctttgagcaa ttggatatta attcacttgc caaccaccgc cttaccatta       480
     tcatggttat tctatgctat tttctggaac ggtgctgtta tgttccatat tcacaagttt       540
     gtgggtagag ttgtctgtaa tgttttgatc tgggatttct taattgttcc agcaatgttc       600
     atactcttct acaatgatta cggcgttgga ctcagttctt cagttttgat gtttggtttg       660
     gggttaggtc aattgcttac aaaggccttc gctttacaat ggatctttgc atttgttatt       720
     gcatctattt tattggtact cagtttgacc gcagcagttg ccggatcgta ctatgttaag       780
     caagatacta ggatcacgga ctctgaagct gcacctttat tatctaatta g                831
//

If you have problems or comments...

PBIL Back to PBIL home page