(data stored in ACNUC6288 zone)

EMBL: CR382138.PE455

CR382138.PE455       Location/Qualifiers
FT   CDS_pept        complement(902448..902912)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F10494g"
FT                   /old_locus_tag="DEHA0F11462g"
FT                   /old_locus_tag="DEHA-IPF8225"
FT                   /old_locus_tag="DEHA-CDS6000.1"
FT                   /product="DEHA2F10494p"
FT                   /note="similar to uniprot|Q02642 Saccharomyces cerevisiae
FT                   YPL037C EGD1 Subunit beta1 of the nascent polypeptide-
FT                   associated complex (NAC) involved in protein targeting
FT                   associated with cytoplasmic ribosomes"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F10494g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89163"
FT                   /db_xref="GOA:Q6BLV1"
FT                   /db_xref="InterPro:IPR002715"
FT                   /db_xref="InterPro:IPR038187"
FT                   /db_xref="InterPro:IPR039370"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BLV1"
FT                   /protein_id="CAG89163.1"
FT                   /translation="MPVDPEKLAKLQKASVAKKVGGSRVKAKKNVKTEQDDTKLIEALG
FT                   KLKAQKIEGIEEANFFKEDGKVLHFNRVGVQGAAQHNTFALTGYPQEKDVTQLIPQILP
FT                   QLGAENLEILRKLAEQIQAGKNPELNAGGAEGAEEDIPDLIEGQKFDDVE"
     atgccagttg atccagaaaa gttagctaag ttacaaaagg cctctgttgc caagaaggtt        60
     ggtggttcaa gagttaaggc taagaagaat gtcaagactg aacaagatga caccaaattg       120
     atcgaagctt taggaaagtt gaaggcacaa aagattgaag gtattgaaga agctaacttc       180
     ttcaaagaag acggtaaggt tttgcacttc aatagagtcg gtgtccaagg tgctgctcaa       240
     cacaacacct ttgctttgac tggttaccca caagaaaagg atgttactca attgatccca       300
     caaatcttac ctcaattggg tgctgaaaac ttggaaatct tgagaaagtt ggctgaacaa       360
     attcaagctg gtaagaaccc agaattgaat gctggcggtg ccgaaggtgc tgaagaagac       420
     atcccggact taattgaagg tcaaaaattc gacgacgtcg aataa                       465
//

If you have problems or comments...

PBIL Back to PBIL home page