(data stored in ACNUC6288 zone)

EMBL: CR382138.PE46

CR382138.PE46        Location/Qualifiers
FT   CDS_pept        103410..105980
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F01166g"
FT                   /old_locus_tag="DEHA0F01375g"
FT                   /old_locus_tag="DEHA-IPF9010"
FT                   /old_locus_tag="DEHA-CDS0690.1"
FT                   /product="DEHA2F01166p"
FT                   /note="weakly similar to uniprot|Q76I27 Pichia pastoris
FT                   PNO1 PNO1 protein and similar to CA4175|IPF4425.repeat2
FT                   Candida albicans IPF4425.repeat2 unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F01166g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG88717"
FT                   /db_xref="GOA:Q6BN07"
FT                   /db_xref="InterPro:IPR007074"
FT                   /db_xref="InterPro:IPR009644"
FT                   /db_xref="UniProtKB/TrEMBL:Q6BN07"
FT                   /protein_id="CAG88717.2"
FT                   /translation="MPQPISGSNIGIGAKSRTLFRKVGNAKTIKFIIVLIAIVNILYIS
FT                   TLLVDERTSSTLTSKIKNHASYVLDNFYESDEEEAEDGTVFTDIPEANTVYSNNQNGQG
FT                   SESIHKYDKTLYNIPNRPYDQLSTSDKILFKLNEITSDSEKYWLGHTELTDYELEIQVD
FT                   DFVKSAWKEKQTIFYDPRFTLAIYINEIKNQYLKKNPDNEKHKSHEIVVPFAWSDWVDL
FT                   TMLNEELSKPESQRKNCEYMKATHHIPAKDADYCINNVAITNADLKEMNLPSTKFVPGF
FT                   AVKKSPTNKASNEVRMLEGKSHLLTYAPNPLAIIFLTNDGVYEAQIEGKQRIVDSNLFE
FT                   DFLTSTKNKDPKIIMNPVKEFNDLLARVKPNPLDPEDDEFGMVAKIKDKNPEKTKEVYL
FT                   PQKAFNYQQDKIDVQLEEYETKMKTLHDLTTNELIFDHHTINKLKLTRNEKIYYEGLKY
FT                   ANKFELAKEPTYFRMARLNFQTEENDHDAGWHYEWRFFNGALRYLKKGWNEEELLIREK
FT                   VLLDRILRNWFKFANEKGIISWIAHGPLLSWYWDGLLFPFDEDIDIQMPAEELTRFSKL
FT                   YNQTLVVEDISEGFGKYFIDCSTFIHHRGKSYKENHIDARFIDIDTGSYIDITGLGISK
FT                   EEAPDKYKDIVNQAAIFNQPKPVYNCRNLHFYSYDEISPLRYTMIGGVPCYIPNKVEDI
FT                   LKDEYTKGMSVYDFEGFYFIDPLNLWIHQQKLKFLFDQSHAHLFNDKEEVTNREEFTNL
FT                   VKGMNEEQILSLLEHNEDILLEYYLTKDVTDLHKQELTYMFNMPDGENTKIGNINGQKQ
FT                   QSEISENLEYHKLTSRFKFQKPFRRPLFNYEKIDKPKHAKPSTA"
     atgccacagc ctatttcagg tagtaatatt ggaatagggg cgaagtctcg gaccctattc        60
     agaaaggtag gtaatgcgaa gacaatcaag tttatcatag ttttgattgc tatcgtaaat       120
     atcctttaca tcagtacctt attggtcgat gaaaggacat cgtccacttt gacgtccaag       180
     attaaaaacc atgcatcata cgttttagac aatttttacg aatcggacga ggaagaggcc       240
     gaagatggga ctgtcttcac agatataccc gaagcaaaca ccgtttattc taacaaccaa       300
     aacgggcaag gaagcgagag cattcataaa tatgacaaga cgttgtacaa tataccaaat       360
     agaccgtacg atcagttgtc aacctcggac aagattttat tcaagttgaa tgaaatcaca       420
     ctggacagcg agaaatactg gttgggacat actgaattaa ctgattacga attagaaatc       480
     caggttgatg attttgtaaa gtcagcctgg aaagagaaac aaacgatttt ttacgatcca       540
     agatttacat tggctattta tattaacgaa atcaaaaacc aatatttgaa gaagaatcct       600
     gataacgaaa agcataagag ccacgaaatc gtggttccat ttgcttggtc tgactgggtc       660
     gatttgacga tgttgaatga agagttatct aaaccagagt cacagagaaa gaattgtgaa       720
     tatatgaagg caacccatca tataccagct aaagatgcag actattgtat taataatgta       780
     gcgattacaa atgctgattt gaaggaaatg aatttaccct caactaagtt tgttcctggt       840
     tttgccgtta aaaaatcgcc aacgaataag gcttcaaatg aggttagaat gttagaaggt       900
     aaatcacatt tattgactta tgcgcctaac ccattagcta ttatcttctt gactaatgat       960
     ggtgtttatg aagcccaaat cgaaggtaag caaagaatcg ttgatagtaa cctttttgaa      1020
     gactttttaa ctagtaccaa gaataaggat cctaagatta ttatgaatcc agttaaagaa      1080
     tttaatgatt tattggcaag ggtaaagcca aatcctttgg atccagagga tgatgaattt      1140
     ggtatggtag ctaagataaa agataaaaat cctgaaaaaa ctaaagaagt ttacttacct      1200
     caaaaagcat ttaattatca acaagacaaa atcgatgtac aacttgaaga atatgaaacg      1260
     aaaatgaaaa ctttacatga tttgacaact aatgagctta tatttgatca tcatacaatt      1320
     aacaaattga aattaactag aaatgaaaaa atatattacg aaggattgaa gtatgcaaac      1380
     aagtttgaat tagctaaaga acctacttac tttagaatgg ctagattaaa ttttcaaaca      1440
     gaagagaatg atcacgatgc tggatggcat tatgagtgga gattctttaa tggagcattg      1500
     cgttatttga aaaaaggctg gaacgaagaa gagttattaa ttagagaaaa ggttttactt      1560
     gatcgtatat taagaaattg gttcaagttt gccaatgaaa agggtattat ctcctggatt      1620
     gcgcatggcc cattgttatc atggtattgg gatggcttat tattcccatt tgacgaagat      1680
     attgatattc aaatgcccgc ggaagaatta acaaggtttt cgaagttata caaccaaaca      1740
     ttagttgtcg aagatattag tgaaggattt ggtaaatatt ttattgactg ttcgacattt      1800
     attcaccaca gaggtaaatc atacaaagag aatcatattg atgctagatt tattgatatt      1860
     gatactggtt cttatattga tattactggt ttaggtataa gtaaagaaga agctcccgac      1920
     aaatacaaag atatagtaaa ccaagctgcc attttcaacc agccaaaacc cgtttacaac      1980
     tgccgtaact tgcatttcta ttcttatgat gaaatttcac cattaagata cactatgatt      2040
     ggcggtgttc catgttacat tccaaacaaa gtcgaggaca ttttgaagga tgaatacacc      2100
     aagggtatgt ctgtctatga tttcgaaggc ttttatttca ttgatcctct taatttgtgg      2160
     attcatcaac agaagcttaa gtttttgttc gaccagtcac atgcacatct cttcaatgac      2220
     aaagaagaag ttaccaaccg tgaagaattt accaacttgg tgaaaggcat gaatgaggaa      2280
     caaatattat ctttgttgga gcataacgaa gatattttat tagagtacta cttaaccaag      2340
     gatgttactg atttgcataa acaagaatta acctatatgt tcaatatgcc agatggcgaa      2400
     aataccaaga ttgggaacat taacggccaa aagcagcaat ctgaaataag tgagaacttg      2460
     gaataccata aactcacatc cagattcaaa ttccaaaaac catttagacg tcctttattt      2520
     aattacgaaa agattgataa accaaaacat gcaaagccgt ctactgcgta g               2571
//

If you have problems or comments...

PBIL Back to PBIL home page