(data stored in ACNUC6288 zone)

EMBL: CR382138.PE473

CR382138.PE473       Location/Qualifiers
FT   CDS_pept        complement(936927..939593)
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F10890g"
FT                   /old_locus_tag="IPF_8194"
FT                   /product="DEHA2F10890p"
FT                   /note="weakly similar to uniprot|Q7SHX8 Neurospora crassa
FT                   NCU00675 Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F10890g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR66320"
FT                   /db_xref="GOA:Q6BLT4"
FT                   /db_xref="InterPro:IPR039786"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BLT4"
FT                   /protein_id="CAR66320.1"
FT                   /translation="MPIFRPKHQKLILQCYPPGKGVDKKPNPSELSYLLYYASTRRVKL
FT                   EKVVTFLDRKTTSDAKHNRAGNLQVTLTIISSLIEECSENLNVFASFVCSILKSVLQSK
FT                   DLSLCKHAIQTYGVLCSKLDGGLFSGDKVFVDSFGSLSQNLINIGSENSKKRGPNNLEW
FT                   QMISLMTCRYISNCLGYNSKFSKKFIEICIPILTETVHANNKQSNLLTILKSNVNIEDE
FT                   NHHLGRIASTKTNQTSRKAQQDLDNDAVKDSDLNEEALRGLKALFSTSLTSQISEATRA
FT                   IVKNNYATTIDPIWGCTFLEMCTTWIPVQLRFITLSTVLSSLTSLSNKSTKKTSNYPIQ
FT                   LLYANYCLGLVSSDVNMIGLSISDVIQQILFLQANLLLSQSHYFQEEDVKKLSMIYSNC
FT                   ICNLSTHIYYFDQVPDSIREILIKVVSILENSVISGNANSSGVYRFIITLLEDISIIFD
FT                   LLQTKPSNISRNHVSLEDWDLSLILLSSEIGLNPTKDQKPLFSYEQITDIQFKYLRVFG
FT                   YFLNNELVTRNENMETGAINSIESFNVGGDHLQPDYNNYISDPGNFIAHFLGYVDKFFS
FT                   GQSLINIDNASLLQKVLKNMILILGINFINNFVPFFFYWQLPLNPNLVDDNTRIKDTLG
FT                   YTLIYHSLIKMDKIYELNYVRESEFFNSLLGDINYRKLNKLWVNGLQSKEEDAVLDNHH
FT                   ALGHRDENGTLRFNPTKKNLEDFVIGNAFTLSWINPHRPLILDIVNNYIPKKENNQNVL
FT                   SDMSDESSIIENSSYHTSARQNGFGLGLGNANDISSIHSGLLFHQSQNVNMKNAFSNGN
FT                   ETSNGSIYTSDRQYNTPRVSDLKDSVLMKKKPGVAFNEHYNSDTTPGSILSKQMVTSDI
FT                   DSILEGLDIDDDSEIIV"
     atgcccatat ttcgtcctaa gcatcagaaa ttgatattac aatgctatcc accgggaaaa        60
     ggtgttgata agaaaccaaa tccatcagaa ttaagctatt tattatatta tgcatccact       120
     cgtcgggtta agttagaaaa agtagttaca tttttagatc ggaaaactac atcagatgct       180
     aagcataata gagcaggcaa tcttcaagtg acattgacta ttatttcatc attgatcgaa       240
     gaatgttcgg agaatttgaa tgtatttgct tcatttgttt gctccatttt gaagtccgtt       300
     ttacaaagta aggatttatc tttgtgcaaa catgccattc agacatacgg tgttttatgt       360
     tccaagctag atggtggctt attttcgggg gataaggtgt ttgttgattc gttcggtagc       420
     ttgtcacaaa acttaataaa tattggtagc gaaaacctga agaaacgagg tccaaacaat       480
     ctagaatggc aaatgatatc gttaatgaca tgccgatata tttctaattg cttgggatac       540
     aatagcaaat ttagtaagaa gttcattgag atttgtattc ctatattaac tgagacggtg       600
     catgcaaata acaagcaatc gaacttattg actattttga aaagcaatgt taacattgaa       660
     gatgagaatc accatctagg gaggattgca ctgactaaga ctaatcaaac aagtagaaaa       720
     gcccaacaag atttggacaa tgacgcagta aaggacagtg atcttaatga agaagcattg       780
     cgaggcttga aggcattatt cagtacgtca ttgactagtc agatctccga agctacaaga       840
     gctattgtca agaataatta tgcaacaaca atagacccta tttggggatg tacattttta       900
     gaaatgtgta cgacttggat cccagttcag ttaagattca ttacattgtc gacagttttg       960
     tcgagcctaa cttcattatc aaataaatct acaaagaaga cttctaatta ccccatacaa      1020
     ttattatatg cgaattattg tttggggttg gtatcatcgg atgttaatat gatagggtta      1080
     tcaatctcgg atgttattca acaaatttta ttcttgcaag ccaacttatt attatctcaa      1140
     tctcattact tccaagaaga ggatgtcaaa aagttgtcta tgatatattc caattgtatt      1200
     tgcaatttgt caacacatat atattacttt gatcaagtgc cagattctat cagggaaatt      1260
     ctaatcaagg tcgtatctat tctagaaaat tcggttattt cggggaatgc aaatagctct      1320
     ggtgtttaca ggttcattat tacgttgctt gaagatattt ccattatttt tgatttactt      1380
     caaacaaaac ctagcaatat tagtagaaat catgttagtt tggaggactg ggaccttagt      1440
     ttaatcttat tatcatctga gattggactc aatccaacca aggatcaaaa gcctttgttt      1500
     tcctatgaac aaattactga tattcagttc aaatatttgc gagttttcgg gtatttttta      1560
     aacaacgaat tagttacaag gaatgaaaat atggaaactg gtgcaattaa cagtattgag      1620
     agctttaatg tgggagggga ccatttacaa cctgattata acaattatat tagtgatcca      1680
     ggcaatttta ttgcccattt cttgggttat gttgataaat tcttttctgg acaatctttg      1740
     attaatatcg ataatgcaag cctcctccag aaggtactaa aaaacatgat attaatttta      1800
     ggtataaatt ttatcaataa cttcgttcca tttttcttct attggcaatt accacttaat      1860
     ccgaatttag tggacgataa tacaagaata aaggatacat tgggatatac tctcatatac      1920
     cattctctta taaaaatgga taaaatatat gaactaaact acgttagaga gtctgagttt      1980
     ttcaatagtt tattgggaga tattaattac agaaaattaa acaaactatg ggttaatggt      2040
     cttcaatcta aagaagaaga tgctgtttta gataatcatc atgcacttgg acatagagat      2100
     gaaaatggca ctttgaggtt taatcctaca aaaaagaact tggaagactt tgtaatcgga      2160
     aatgcgttta cattgtcttg gatcaatcct catagacctt taattttgga tattgttaac      2220
     aattacattc caaagaaaga gaataatcaa aatgttttat ctgacatgtc agatgagtct      2280
     tcaattattg aaaatctgag ttatcatacg tcggcaagac agaatgggtt cggtttagga      2340
     ttaggtaatg caaatgacat ctcatcgatt cattcggggt tattatttca ccaaagccaa      2400
     aatgttaata tgaaaaatgc attctcaaat ggaaatgaaa cttccaatgg gtcgatttac      2460
     acgtcagata gacaatataa cacgcctcgt gtgtcagact taaaagatag cgttctaatg      2520
     aaaaagaaac caggggttgc attcaatgag cattataatt ctgacaccac tcccgggtct      2580
     atattgtcga aacagatggt tacgtccgat attgattcaa tcctagaagg attagatata      2640
     gacgatgact ctgaaattat tgtatga                                          2667
//

If you have problems or comments...

PBIL Back to PBIL home page