(data stored in ACNUC6288 zone)

EMBL: CR382138.PE474

CR382138.PE474       Location/Qualifiers
FT   CDS_pept        941905..944205
FT                   /transl_table=12
FT                   /locus_tag="DEHA2F10912g"
FT                   /old_locus_tag="DEHA0F11924g"
FT                   /old_locus_tag="DEHA-IPF8191"
FT                   /old_locus_tag="DEHA-CDS0926.1"
FT                   /product="DEHA2F10912p"
FT                   /note="weakly similar to uniprot|Q12033 Saccharomyces
FT                   cerevisiae YOR275C RIM20 Protein involved in proteolytic
FT                   activation of Rim101p in response to alkaline pH"
FT                   /db_xref="EnsemblGenomes-Gn:DEHA2F10912g"
FT                   /db_xref="EnsemblGenomes-Tr:CAG89184"
FT                   /db_xref="InterPro:IPR004328"
FT                   /db_xref="InterPro:IPR025304"
FT                   /db_xref="InterPro:IPR038499"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6BLT2"
FT                   /protein_id="CAG89184.2"
FT                   /translation="MNTNLLYIPYRETDIIDLGNELRNIIKMEYFQPSSNFDRDLQAVR
FT                   NLRNNISNLKNEQVNNNDETVCVQYYHQLSNVIKKFPDECVEFSWYGTLGYGRSGPTRS
FT                   RSLRIEQLNILYQLGSYFSQAALMESRYSDEGLKKSCSYLQAAAGCFNSMILQIQKENE
FT                   KETGMIRIPRDLQPETLQFLKSLMIAQAQETIWQKSLASGMKDSVIARLSIQTSEYYST
FT                   AAKYGNSSEFIKLEWINHVTVKQFHFKAAAHYRVSILNHEGFKYGEQVASLQVALSSCD
FT                   SAFRKKKYVNDFVIEDLQGLTETIKSTLRVAEKDNDLVYLKPVPKENDLAPIPGASLVK
FT                   PILPPAIESFDDSSVLFKELLPYLIVQVGQAYRERQDSFIRDSFIDPIQSLNKIMYKFI
FT                   TERNLPASIDTIQKPENLPESIIQHSQEIISYGGTKLIEDSLNEIAKLTLESRHILEGC
FT                   QERLKIEADEDDIMRERQGSQRWARPKSSEASSEFINKINKMEQYLDQAKEGDQFIISQ
FT                   YHEIEPYLQLYCGGYKELIQFIPNSTYVKLDTKINEIIIKLRELINEVSRIENQRKQFL
FT                   TRIEIKARNNNILPSIIDSFKKKQRKLYEENAAIDERSFEDVYAKHITMFNSDLRFLED
FT                   SKHAQIALEGNIDDLNQEFESEYQHTNNESQYKRQEVLQTLENVYTKYLELISNLNEGS
FT                   KFYSDFIIKSNSVLKECDEYVYHRRVEGRELEMFLNNQAVPVESVGSQQSAPDFPPQPM
FT                   GGTWNPNNGIKFG"
     atgaatacaa atctattata tattccgtat cgtgaaaccg atattataga tttagggaat        60
     gaattgagaa atattataaa gatggagtat tttcagccat catcaaattt tgatagagac       120
     ctccaggcag taagaaactt acgaaataat ataagtaatt tgaaaaatga acaagtcaat       180
     aacaacgacg aaacggtatg tgttcaatac taccatcagc tcagcaatgt gatcaaaaaa       240
     tttccagacg aatgcgttga gttttcatgg tatggtacgt taggatatgg aagaagtggc       300
     cctactagat caagatcatt aagaatcgag caattgaata ttttatatca attgggatct       360
     tatttttcac aggcggcgtt aatggaatca aggtatagcg atgaaggttt gaaaaaatcc       420
     tgttcatatt tacaggctgc ggctggttgt tttaatagca tgattttaca aatacaaaaa       480
     gagaatgaaa aagagacagg aatgattcgt attcctagag acttacagcc tgaaacattg       540
     caatttttga aaagtttaat gatagcccaa gcgcaggaaa ctatatggca aaagtcactt       600
     gcatcaggaa tgaaggattc ggtcatagct agattatcaa ttcaaacctc ggaatattat       660
     tctactgcag ccaagtatgg caactcatct gaattcatca agttagagtg gataaatcat       720
     gtaacagtca agcaatttca cttcaaagct gctgcacatt atagagtatc tattctcaat       780
     cacgaaggct ttaaatacgg agagcaagtt gcgagcttac aagtagctct tagcagctgt       840
     gattctgcgt ttagaaaaaa gaagtatgtg aatgattttg ttattgaaga tttacaaggt       900
     ttaactgaaa ctattaagag caccttaagg gtcgccgaga aagacaatga tttagtctat       960
     ttgaaacctg taccgaaaga aaatgattta gccccgattc ccggggcatc tctagtgaaa      1020
     cccattttac caccagcaat agagtcattc gacgacagta gtgtattgtt taaagagtta      1080
     ttaccttatc taatcgttca ggtgggtcaa gcatatcgtg agagacagga ctcatttatt      1140
     agggatctgt ttatcgaccc aattcaatcg ttaaataaaa ttatgtacaa attcataacc      1200
     gaacggaatc taccagcgtc aattgatact attcaaaaac cagaaaattt acccgaatct      1260
     attatacaac attcgcaaga aataatatct tatggtggga caaaactcat tgaagattca      1320
     ttaaatgaaa ttgcaaaatt gacattggaa agtagacata ttttagaagg gtgtcaagaa      1380
     agattaaaaa ttgaagccga tgaagatgat attatgagag agagacaagg ttctcaacga      1440
     tgggcaagac cgaaatcgag tgaagcatcg tccgaattta tcaataaaat aaacaaaatg      1500
     gaacaatatt tagatcaagc taaagagggc gatcagttta tcatatctca gtatcatgag      1560
     attgaaccat atttgcagtt gtattgtggt ggctataagg agttaataca attcattccc      1620
     aattcaactt acgtcaagtt agacaccaaa atcaatgaaa ttattatcaa actaagggag      1680
     ttgataaatg aagttagtag gatagagaat caaagaaaac aatttttgac aaggatagaa      1740
     ataaaggcca gaaataataa tattctccca agtataattg atagctttaa aaagaagcaa      1800
     cgcaaacttt acgaggaaaa tgcagcaata gatgaaagat cattcgagga tgtctatgca      1860
     aagcatatca caatgttcaa cagtgacctt agatttttgg aagatctgaa acatgcacaa      1920
     attgcattgg aagggaatat tgacgacttg aatcaggaat ttgaatctga atatcaacac      1980
     acgaataatg aatcacaata taagagacaa gaagtactac agactttaga aaatgtctat      2040
     actaaatatt tggaattgat atcgaatcta aatgaggggt caaaattcta cagtgatttc      2100
     attatcaaaa gtaatagtgt gctaaaggaa tgtgatgaat atgtatatca ccgcagagta      2160
     gagggaagag aacttgaaat gttcttgaat aatcaagcag tgccagtaga atcagtaggc      2220
     tctcagcaac tggcccctga ttttcctccc cagcctatgg gtggtacatg gaacccaaat      2280
     aacggtataa agtttggata g                                                2301
//

If you have problems or comments...

PBIL Back to PBIL home page